KEGG   Bacillus cereus ATCC 14579: BC1237Help
Entry
BC1237            CDS       T00127                                 

Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00260  Glycine, serine and threonine metabolism
bce00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bce01100  Metabolic pathways
bce01110  Biosynthesis of secondary metabolites
bce01130  Biosynthesis of antibiotics
bce01230  Biosynthesis of amino acids
Module
bce_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BC1237
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BC1237
Enzymes [BR:bce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BC1237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 1203586
NCBI-ProteinID: NP_831021
UniProt: Q81GG5
Position
1212177..1213370
Genome map
AA seq 397 aa AA seqDB search
MNYAYPDEKGHYGIYGGRYVPETLMQSVLELEEAYKEAMQDEAFQKELNHYLKTYIGRET
PLYYAENMTKYCGGAKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGAGQHG
VATATVCALLGLECVIFMGEEDVRRQKLNVFRMELLGAKVESVAAGSGTLKDAVNEALRY
WVSHVHDTHYIMGSVLGPHPFPQIVRDFQSVIGNETKKQYEALEGKLPEAVVACIGGGSN
AMGMFYPFVHDEEVALYGVEAAGKGVHTEKHAATLTKGSVGVLHGSMMYLLQNEEGQIQE
AHSISAGLDYPGVGPEHSLLKDIGRVSYHSITDEEALEAFQLLTKKEGIIPALESSHAVA
YALKLAPQMKKDEGLVICLSGRGDKDVESIKRYMEEV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgcatatccagatgaaaaaggacattacggtatatacggaggacgatacgtt
ccagaaacgttaatgcaatctgtactagaactagaagaagcatataaagaagcgatgcaa
gatgaagcatttcaaaaggaattaaatcattatttaaaaacgtacatcggaagagaaaca
ccgctatattatgctgaaaatatgacgaagtattgcggtggtgcaaagatttatttaaaa
cgtgaagatttgaatcatacaggagctcataaaattaacaatacaatcggtcaggcacta
cttgcagtgcgaatgggcaagaaaaaagttgtcgctgaaacaggagctggacaacacgga
gttgcaacagctactgtatgtgctcttctcggattagaatgcgtcatttttatgggagaa
gaagatgtaagacgtcaaaaattaaatgtgttccgaatggaattactcggagcgaaagta
gaaagtgtagcggcaggtagtggtacattaaaagatgcggtaaacgaggcgcttcgttac
tgggtttcacatgtgcatgatacgcactacattatgggatctgttctcggaccacatcca
ttcccgcaaattgtacgtgatttccaaagtgtaattggaaatgaaacgaaaaaacaatat
gaggcgttagaaggaaagttaccagaagcagtcgttgcttgtattggcggtggcagtaat
gcgatgggaatgttttatccgttcgtacacgatgaagaagttgctctttacggcgtagaa
gcagctggaaaaggcgttcatacagaaaagcatgcagcaactttaacgaaaggaagcgtt
ggcgttctccacggatcaatgatgtatcttctgcaaaacgaagaaggacaaattcaagaa
gcacactctatttcagcaggacttgattatccaggtgttggtccagaacatagcttgcta
aaagatattggccgcgtttcctatcattcgataacagacgaagaagcattagaagcattt
caattattaacgaaaaaagaaggcattatcccggcgttagaaagctcgcatgctgtcgca
tacgcattaaaattagcgccgcaaatgaagaaagatgaagggcttgtcatttgtttatct
ggccgcggtgataaagatgtagagagtataaaacgttatatggaagaggtgtaa

DBGET integrated database retrieval system