KEGG   Bacillus cereus ATCC 14579: BC1238Help
Entry
BC1238            CDS       T00127                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bce01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bce00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bce00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1213374..1214150
Genome map
AA seq 258 aa AA seqDB search
MGVEKIKAAFENGKKAFIPYVMGGDGGLEKLKERIRFLDEAGASIVEIGIPFSDPVADGP
TIQRAGKRALDSGVTLKGIFQALAEVRKEVQMPFVLMTYLNPVLAFGKERFIENCIEAGV
DGIIVPDLPYEEQNIIAPLLREVNIALIPLVTVTSPIERIEKITSESEGFVYAVTVAGVT
GVRQNFKEEIHSYLEKVKSHVNLPVVAGFGISTKEHVEEMVTICDGVVVGSKVIELLENE
KREEICELIYATKQKEEA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgggagtagaaaaaattaaagcagcgtttgaaaatggcaagaaagcatttattccgtac
gtaatgggcggagatggtggccttgaaaaattaaaagaaagaattcgttttcttgatgaa
gcaggagcaagcatcgttgaaattggtattccgttttcagatccagttgcagatggccca
acgattcaaagagcagggaaacgagcgctagatagcggcgtaacattaaaaggcattttt
caagcgttagcagaggtaaggaaagaagtacaaatgccctttgttcttatgacatattta
aatccggtacttgcattcggaaaagagagattcatcgagaactgtatagaagcaggtgta
gacggcatcatcgttccagacttaccgtatgaagaacaaaatattattgcgccgttactt
cgagaggtaaacattgcgctcatcccactggttaccgtaacgagtcctattgaaagaatt
gaaaaaattacgagtgaatcagaagggttcgtttatgctgttacagtagcgggcgtaacg
ggagtacgtcaaaactttaaagaggagattcatagttacttagaaaaagtaaaatcacac
gtcaacttaccagtagtcgctggattcggcatctcaacaaaagaacatgtagaagaaatg
gttacaatatgcgacggagttgtcgttggaagtaaggtcattgagcttttagaaaatgaa
aagcgagaagaaatatgtgaattaatatatgcaacaaaacaaaaagaagaggcatag

DBGET integrated database retrieval system