KEGG   Bacillus cereus ATCC 14579: BC1406Help
Entry
BC1406            CDS       T00127                                 

Gene name
hisD
Definition
(RefSeq) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00340  Histidine metabolism
bce01100  Metabolic pathways
bce01110  Biosynthesis of secondary metabolites
bce01230  Biosynthesis of amino acids
Module
bce_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    BC1406 (hisD)
Enzymes [BR:bce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BC1406 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-GeneID: 1203755
NCBI-ProteinID: NP_831186
UniProt: Q81G06
Position
1369735..1371024
Genome map
AA seq 429 aa AA seqDB search
MEIIYEEFKEALSKIKVLRENANIIEETVQRSVREIIRHVREGKDEALSFYTKKFDGVEM
KNFRVSEEEIQQASMFVENSFLEALKEAKKNVVSYHEKQKKHSIFDCESKGIIRGQLIRP
LENIGVYVPGGTASYPSSVLMNVLPAKLAGVKKIVMVTPPRKGGIDPHILAAADLAGVDE
IYTIGGAQAIAALAYGTESIPKVDKIVGPGNLYVALAKREVYGIVNIDMIAGPSEIVVVA
DETGNAKYIAADLLSQAEHDERATAICITTNMELAKEVEKEVERQLETLPRSEIARESIN
RNGAIFIVPSLEEALKLSNEIAPEHLELHIKEPMNALDYVKHAGSIFLGPYSPEPLGDYL
AGPNHVLPTSGTARFFSPLSVDDFVKKSSFISYTEEALKNVQHHIVELANKEGLHAHARA
IQIRFEEEK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcatttatgaagaatttaaggaggcattatctaaaataaaagtgctaagagaa
aacgctaatataatagaagaaactgttcaaagaagtgtaagagaaatcattagacatgta
agggaagggaaagatgaggctttatctttctatacaaaaaagtttgatggtgtagagatg
aaaaattttcgtgtaagtgaagaagaaatacagcaagcgagtatgtttgtagagaattca
tttttagaagctttaaaagaggcgaagaaaaacgttgtttcgtatcacgaaaagcaaaag
aagcactcaatattcgattgtgaaagtaaagggataattagagggcaactcattcggccg
ttagaaaatataggtgtatatgtaccgggtgggacagcctcatatccttcttcagtatta
atgaatgtattgccggcgaaactcgcaggtgtgaaaaagattgtaatggtaacaccgccg
aggaaaggaggaattgatccgcatatattagctgctgcagatcttgcgggagtagatgaa
atttatacgataggtggcgcacaagcaattgctgctttagcatacgggacggaatcgatt
ccgaaagtggataaaatagttggaccgggaaatttgtacgtcgctctagcgaaacgagaa
gtatacggaatagtaaatatcgatatgattgctggtccatcagaaattgtagttgtcgcg
gatgaaacaggtaatgcaaaatatatcgcagcggatttattatcgcaagcagagcatgat
gagagagcaacggcgatttgtattacaacgaatatggaactagctaaagaagtggaaaaa
gaggtagaaagacagttagaaacgttaccaagaagtgaaattgcacgtgaatcaataaat
agaaatggagccatctttatcgttccttctttagaggaggcgctaaagttatcaaatgaa
attgctccagaacatttagagttacatataaaagaaccaatgaatgctctagattatgtg
aaacatgcaggctctattttccttgggccatattcacctgaaccgctcggggattattta
gcgggaccgaatcatgtattaccaacgagcggaacggcaagatttttttctccgttatca
gtcgatgatttcgtgaaaaaatcaagttttatttcttatacggaggaggcattaaaaaat
gtacagcatcatattgtagagcttgcaaataaagaagggttacatgcacatgcgagagca
atccaaataaggtttgaggaggaaaaataa

DBGET integrated database retrieval system