KEGG   Bacillus cereus ATCC 14579: BC1691Help
Entry
BC1691            CDS       T00127                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1691
   01230 Biosynthesis of amino acids
    BC1691
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1691
  Energy metabolism
   00680 Methane metabolism
    BC1691
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BC1691
Enzymes [BR:bce01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BC1691
Exosome [BR:bce04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BC1691
  Exosomal proteins of melanoma cells
   BC1691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1641022..1641597
Genome map
AA seq 191 aa AA seqDB search
MTTIYFVRHAHSTYTKEERERPLSEKGHCDAENVTHLLKDKHIDVVISSPYKRAIQTVQG
IANTYKLSIQTEEDLRERLLSTEPVSNFNDAMQNVWEDWSFAYEGGESNDIAQRRAVICM
QNILKQYEGKNIVIGTHGNIMVLLMNYFNSKYDFEFWKTLHMPDVYKLNFDKNRFISAER
IEKTGHRLNIL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaatatatttcgttcgccatgcccattctacatatacaaaagaagaacgggaa
cgacctttatctgaaaaagggcactgtgatgcagagaatgtaacacatttattaaaagat
aaacatattgatgttgttatttctagtccgtacaaaagagcaatccaaactgtacaagga
attgcgaatacatataaattatcaatacaaacagaagaagatttgcgtgaaagattattg
agcacagagccagtatcaaattttaatgatgctatgcagaatgtgtgggaagattggagt
tttgcatacgaaggcggagaatcgaatgatatcgcacaaaggcgcgctgtaatatgtatg
caaaatatattaaaacaatatgaaggtaagaatattgtaataggtacgcatggaaatatt
atggtattactcatgaattattttaattcgaaatatgattttgagttttggaaaacactt
catatgcctgatgtgtataaattaaattttgataaaaatcgtttcatttctgctgaaaga
atagagaaaacaggtcatcggttaaatattttgtaa

DBGET integrated database retrieval system