KEGG   Bacillus cereus ATCC 14579: BC1691Help
Entry
BC1691            CDS       T00127                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC1691
   01230 Biosynthesis of amino acids
    BC1691
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC1691
  Energy metabolism
   00680 Methane metabolism
    BC1691
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BC1691
Enzymes [BR:bce01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BC1691
Exosome [BR:bce04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BC1691
  Exosomal proteins of melanoma cells
   BC1691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1641022..1641597
Genome map
AA seq 191 aa AA seqDB search
MTTIYFVRHAHSTYTKEERERPLSEKGHCDAENVTHLLKDKHIDVVISSPYKRAIQTVQG
IANTYKLSIQTEEDLRERLLSTEPVSNFNDAMQNVWEDWSFAYEGGESNDIAQRRAVICM
QNILKQYEGKNIVIGTHGNIMVLLMNYFNSKYDFEFWKTLHMPDVYKLNFDKNRFISAER
IEKTGHRLNIL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaatatatttcgttcgccatgcccattctacatatacaaaagaagaacgggaa
cgacctttatctgaaaaagggcactgtgatgcagagaatgtaacacatttattaaaagat
aaacatattgatgttgttatttctagtccgtacaaaagagcaatccaaactgtacaagga
attgcgaatacatataaattatcaatacaaacagaagaagatttgcgtgaaagattattg
agcacagagccagtatcaaattttaatgatgctatgcagaatgtgtgggaagattggagt
tttgcatacgaaggcggagaatcgaatgatatcgcacaaaggcgcgctgtaatatgtatg
caaaatatattaaaacaatatgaaggtaagaatattgtaataggtacgcatggaaatatt
atggtattactcatgaattattttaattcgaaatatgattttgagttttggaaaacactt
catatgcctgatgtgtataaattaaattttgataaaaatcgtttcatttctgctgaaaga
atagagaaaacaggtcatcggttaaatattttgtaa

DBGET integrated database retrieval system