KEGG   Bacillus cereus ATCC 14579: BC1788Help
Entry
BC1788            CDS       T00127                                 

Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BC1788
Enzymes [BR:bce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BC1788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1741000..1741923
Genome map
AA seq 307 aa AA seqDB search
MNVQESFVTALDGSEIYLRKWLPEGDPRGIIQIAHGMTEHAGVYTEFVDALLEAGYGVYA
HDHKGHGKTVKKEEDYGHFEPNIGWNQVVSDVIFVSEKIKEEQSSPLFLLGHSMGSFLSR
RAVQLRGELYDGFLISGTGGNPGLLGAIGHKVATIEMKLRGAKTKSPMLNFLSFGNFNSN
FKPNRTKFDWLSSDNNQVDKYIADPLCGFICTTSFYRELFSGVLEVNKLEEYKKTPKNLP
IHIFSGDRDPVGDMGKGVKEVYENYKKCGVKDVTLRLYENGRHEMFHEVNKDEVFKDLIS
WLDAHNK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtacaggaaagtttcgttacggcattggatggatcggaaatttatttgcgtaag
tggttaccagaaggagatccgagaggaattattcaaattgcacatggcatgacagagcat
gcaggggtgtatacagaatttgtagatgctttattggaagcagggtatggtgtttatgcg
catgatcataaaggacatgggaaaacagtaaaaaaagaagaagattatggtcattttgaa
ccaaatataggctggaatcaagttgtatcggatgttatctttgtttcagaaaagataaaa
gaagagcagtcaagtcctttgtttttacttggacatagtatgggttcttttttatcaaga
cgtgctgtacaacttagaggcgaattatatgatggatttctgatttcaggaacaggtgga
aatccagggcttttaggagctattggtcataaagtagcaacaatcgaaatgaaattgcgt
ggggcaaaaacgaaaagtccaatgttaaactttttatctttcggaaacttcaattcgaac
tttaagccaaatcgtacaaaatttgattggttatcttcagataataatcaagttgataaa
tatattgcggatccgttatgtggtttcatttgtacgacgagtttttaccgagaattattt
tctggtgtattagaagtaaataaactagaagaatacaagaagacgccaaagaatcttcca
atacatatattctctggtgatcgtgatcctgttggcgatatggggaaaggtgtaaaagaa
gtatatgaaaactataaaaaatgtggtgtgaaagacgtgacactacgtttatatgaaaat
ggtagacatgaaatgtttcatgaagtaaataaggatgaagtatttaaagatttaatttcg
tggttagatgcgcataataaatga

DBGET integrated database retrieval system