KEGG   Bacillus cereus ATCC 14579: BC1788Help
Entry
BC1788            CDS       T00127                                 

Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bce00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1741000..1741923
Genome map
AA seq 307 aa AA seqDB search
MNVQESFVTALDGSEIYLRKWLPEGDPRGIIQIAHGMTEHAGVYTEFVDALLEAGYGVYA
HDHKGHGKTVKKEEDYGHFEPNIGWNQVVSDVIFVSEKIKEEQSSPLFLLGHSMGSFLSR
RAVQLRGELYDGFLISGTGGNPGLLGAIGHKVATIEMKLRGAKTKSPMLNFLSFGNFNSN
FKPNRTKFDWLSSDNNQVDKYIADPLCGFICTTSFYRELFSGVLEVNKLEEYKKTPKNLP
IHIFSGDRDPVGDMGKGVKEVYENYKKCGVKDVTLRLYENGRHEMFHEVNKDEVFKDLIS
WLDAHNK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtacaggaaagtttcgttacggcattggatggatcggaaatttatttgcgtaag
tggttaccagaaggagatccgagaggaattattcaaattgcacatggcatgacagagcat
gcaggggtgtatacagaatttgtagatgctttattggaagcagggtatggtgtttatgcg
catgatcataaaggacatgggaaaacagtaaaaaaagaagaagattatggtcattttgaa
ccaaatataggctggaatcaagttgtatcggatgttatctttgtttcagaaaagataaaa
gaagagcagtcaagtcctttgtttttacttggacatagtatgggttcttttttatcaaga
cgtgctgtacaacttagaggcgaattatatgatggatttctgatttcaggaacaggtgga
aatccagggcttttaggagctattggtcataaagtagcaacaatcgaaatgaaattgcgt
ggggcaaaaacgaaaagtccaatgttaaactttttatctttcggaaacttcaattcgaac
tttaagccaaatcgtacaaaatttgattggttatcttcagataataatcaagttgataaa
tatattgcggatccgttatgtggtttcatttgtacgacgagtttttaccgagaattattt
tctggtgtattagaagtaaataaactagaagaatacaagaagacgccaaagaatcttcca
atacatatattctctggtgatcgtgatcctgttggcgatatggggaaaggtgtaaaagaa
gtatatgaaaactataaaaaatgtggtgtgaaagacgtgacactacgtttatatgaaaat
ggtagacatgaaatgtttcatgaagtaaataaggatgaagtatttaaagatttaatttcg
tggttagatgcgcataataaatga

DBGET integrated database retrieval system