KEGG   Bacillus cereus ATCC 14579: BC1965Help
Entry
BC1965            CDS       T00127                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00260  Glycine, serine and threonine metabolism
bce00750  Vitamin B6 metabolism
bce01100  Metabolic pathways
bce01110  Biosynthesis of secondary metabolites
bce01120  Microbial metabolism in diverse environments
bce01230  Biosynthesis of amino acids
Module
bce_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BC1965
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BC1965
Enzymes [BR:bce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BC1965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-GeneID: 1204314
NCBI-ProteinID: NP_831735
UniProt: Q81EK5
Position
1912916..1913974
Genome map
AA seq 352 aa AA seqDB search
MYKGLLKQYASYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKD
RGMVMAVAKAKEEGSEAIICASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVA
YGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIEGQKTAAFEICDQLQNAPDVL
AIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIEEPETIATAIRI
GNPASWSYAVEAAEQSCGEIDMVSDEEILHAYRLLAKTEGVFAEPGSNASLAGVIKHVKS
GKIKKGETVVAVLTGNGLKDPDIAISSNQLDIASLSNDIEQIKDHIKGVIMS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggactattgaaacaatatgcttcttatttaccggtgaatgaaaacacacct
gatgtcagtttaatggaaggaaatacacctcttattccgttattaaatatatcaaagcaa
ttagggattcagctatatggtaagtacgaaggagcgaatccgacaggttcttttaaagat
cgtggtatggtgatggcagttgctaaggcgaaagaagaaggttcagaagcaatcatttgt
gcatcaacaggtaatacatcagcatcagctgcagcatatgcggcacgtcttgggatgaaa
tgtataatcgtaatccctgaaggaaagattgcgcatggaaaattagcgcaagcggtcgct
tatggagctgaaattatttcaatagaagggaatttcgatgatgcacttaaggctgtaaga
aatattgctgcagaagagccgattacattagtaaattcagtgaatccttatcgaattgaa
ggacaaaaaacggcagcatttgaaatttgtgaccaattgcaaaatgcaccagatgttcta
gctatccctgttgggaacgcagggaatattacagcatattggaaaggtttctgtgaatat
gagaaagaaaaaggttataagaagccaagaattcatggttttgaagcagaaggagcagct
gcaattgtaaaagggcatgtaattgaagaacctgaaacaattgcaacagcgattcgcatc
ggtaacccagcaagttggtcgtatgcagtagaggctgccgagcagtcttgtggtgaaata
gatatggtatcagatgaagaaattttacatgcgtataggttattagcaaaaactgaagga
gttttcgctgaaccaggatcaaatgcttcattagctggcgtaattaaacatgttaaatct
ggaaaaatcaaaaagggagaaacagttgttgcagtattaactggaaatggtttgaaggat
cctgatatcgctatttcttcaaatcaactagacatcgcaagtttgtcaaatgatatagaa
cagattaaagatcatattaaaggggtgattatgtcgtga

DBGET integrated database retrieval system