KEGG   Bacillus cereus ATCC 14579: BC2059Help
Entry
BC2059            CDS       T00127                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC2059
   01230 Biosynthesis of amino acids
    BC2059
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC2059
  Energy metabolism
   00680 Methane metabolism
    BC2059
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BC2059
Enzymes [BR:bce01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BC2059
Exosome [BR:bce04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BC2059
  Exosomal proteins of melanoma cells
   BC2059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2001943..2002533
Genome map
AA seq 196 aa AA seqDB search
MQILLIRHGESEADILHVHEGRADFELTDKGRQQVQRLVQKVKKDFAPDFIWASTLKRAR
ETGETLAEAIGCPIQLEEELMEFNNGVQAGLSFEEAKKYPEPKFLHDRFENGESFIEFRM
RIEGIFSKILTENTYDRIAIVAHGGVINSLLRAFFKMPISMDYYFKMGDTGISLIEIEGE
QKTVHFINDTNHLDGM
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatactactaatacgccacggagaatcagaagctgatattttacatgtgcatgaa
ggtcgagctgattttgagttaactgacaaagggagacaacaagtacaaagacttgtacag
aaagtgaaaaaagattttgcaccagatttcatttgggcaagcacattaaaacgcgctcgt
gaaacgggtgaaacattagcagaagcaattggttgtccaattcaattagaagaggaatta
atggagtttaataatggagtgcaagcaggcttatcatttgaagaagcaaagaaatatcca
gagccaaagtttcttcatgatcgttttgaaaacggggaatcgtttattgagtttcgaatg
agaatagaaggaatcttttctaaaatcttgacagagaatacatatgaccgaattgcaatt
gttgcccatgggggcgtaattaatagtctattacgtgcatttttcaaaatgccaatttca
atggactactatttcaaaatgggagatacgggaataagtttaattgaaattgagggtgaa
caaaaaacggtgcatttcattaatgatacgaatcatttggacgggatgtaa

DBGET integrated database retrieval system