KEGG   Bacillus cereus ATCC 14579: BC2114Help
Entry
BC2114            CDS       T00127                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:bce00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bce00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
2055473..2055955
Genome map
AA seq 160 aa AA seqDB search
MTVYDFSAKTITGEEKSLKDYKGKALLIVNVASKCGFTPQYKGLQEVYDKYKDQGLEILG
FPCNQFGGQEPGTEADITSFCELNYGVNFPMFAKVDVKGDKAHPLYTYMTEQAPGLLGMK
AVKWNFTKFLIGKDGKVVGRFAPQTKPVDLEVEIEKVLGE
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacagtttatgatttttcagctaaaacaattacaggtgaagaaaaatcgttaaaagat
tacaaaggaaaagcacttcttattgtcaatgtagctagcaaatgtggtttcacaccacaa
tataaaggattacaagaggtatatgataaatataaagaccaaggactcgaaatactcgga
tttccttgtaaccaattcgggggacaagaaccaggtacagaagcggacattactagtttt
tgtgaattaaactacggtgtaaacttcccgatgtttgcaaaggttgatgtgaaaggtgat
aaggctcaccctctatatacatacatgacagaacaagcaccaggtttacttggtatgaaa
gcagtgaaatggaattttacgaagtttttaatcggaaaagacgggaaagtagtagggcgt
tttgctccgcagacgaagccggtagatttagaggttgagattgagaaggtgcttggagaa
taa

DBGET integrated database retrieval system