KEGG   Bacillus cereus ATCC 14579: BC2354Help
Entry
BC2354            CDS       T00127                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BC2354
Enzymes [BR:bce01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BC2354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
2300739..2302130
Genome map
AA seq 463 aa AA seqDB search
MKTVVVIGGGITGLSTMFYLEKLKKDYNIDLNLILIEKEEYLGGKIHSVEEKDFIMESGA
DSIVARNEHVMPLVKDLNLEDEMVYNETGISYIYSENMLHPIPSDTIFGIPMSVQSLFSS
TLVSTKGKIVALKDFITKNKEFTKDTSLALFLESFLGKELVERQIAPVLSGVYSGKLNEL
TMASTLPYLLDYKNKYGSIIKGFEENKKQFQSAGNKKFVSFKGGLSTIINRLEEVLTETV
VKKGVITTAVSKQEDRYEISFANHETIQADYVVLAAPHDIAQTLLQSNELNEQFNTFKNS
SLISIYLGFDILDEQLPADGTGFIVTENSDLHCDACTWTSRKWKHTSGKQKLLVRMFYKS
TNPVYETIKNYSEEELVRVALYDIEKSLGIKGEPEVVEVTNWKDLMPKYHLEHNQAVQAL
QEKMTNLYPNVYLAGASYYGVGIGACIGNGKNIANEIMDTLNK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagttgttgttatcggtggaggtataacgggactttctactatgttttattta
gaaaaattaaaaaaggattataatatcgatttaaatttaattcttattgagaaagaagag
tatttaggtggtaaaatccatagtgtggaagaaaaggatttcattatggagtcaggggcg
gattcaatcgttgctcgtaatgaacacgttatgccacttgtaaaagatttaaatttagaa
gatgaaatggtatataatgaaacaggtatttcttacatatattctgaaaacatgttacat
ccgattccttctgatactatatttgggataccgatgagcgtccagtcgttgtttagcagt
acgctagtctcaacgaaggggaaaatcgtagctttaaaagatttcataacgaaaaataaa
gagtttacgaaagatacatcacttgctttatttttagaaagctttttagggaaagagtta
gtggaaagacaaattgctcctgtgctttcaggcgtatattctggtaaattgaatgagctt
acaatggcatctacattaccgtatttactggattataaaaataagtatggaagtattatt
aaaggttttgaagagaataaaaaacaatttcaatcagcaggaaataaaaaattcgtatca
tttaaaggtggactatctacgataattaatcgcttagaagaagtgctgactgaaactgtc
gtaaaaaaaggtgttataacgacggctgtaagtaaacaagaagatcgatatgagatttct
tttgcaaatcatgaaacaatacaagctgattatgttgttttagcagctccacatgatatt
gcacaaactttattacagtctaatgagttaaatgagcagtttaatacatttaaaaactca
tctcttataagtatttatttaggatttgacatactagatgaacaactaccagctgatggt
acggggtttattgtaacggaaaacagtgatttacattgtgatgcttgtacatggacaagt
cgaaagtggaaacatacatcgggtaaacaaaaattattagttagaatgttttataagagt
accaatccggtatatgaaacaatcaagaattacagtgaagaagaattagtacgagtcgct
ttatatgatattgaaaagagtctcggaattaaaggtgaaccagaagtagttgaagttaca
aattggaaagatttaatgccgaaatatcatttagaacataatcaagcggttcaagcatta
caagaaaaaatgacgaatctttatccaaatgtatatttagctggtgcctcatattatggt
gttggaattggtgcgtgtattggaaatggaaagaatatagccaatgaaataatggataca
ttaaataaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system