KEGG   Bacillus cereus ATCC 14579: BC2529Help
Entry
BC2529            CDS       T00127                                 

Definition
Zn-dependent alcohol dehydrogenase and related dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BC2529
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC2529
  Lipid metabolism
   00071 Fatty acid degradation
    BC2529
  Amino acid metabolism
   00350 Tyrosine metabolism
    BC2529
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BC2529
   00626 Naphthalene degradation
    BC2529
Enzymes [BR:bce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BC2529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2502044..2502970
Genome map
AA seq 308 aa AA seqDB search
MEQYKLVLEGAKQLKWETNEIKDIQDDEIIVKTIAGSISIGAELPQYNGSDVTDPHPFYP
RKTGYESYGEVIEVGNQVTHVNVGDKVVSFYGHETIGIVKAHKVIRVPSSIQPKIALLSI
LSCDAAKGVLKLNPRQDEKVLIIGMGVIGLLACYFLKYYVGIEHVDVVEPNKNRRDFAKK
FGTKNIYDSEEKIIETYNYGFECSATNSGFHTLQKALKTNGKICILSDGNIEELTLTANF
YQKELQIIGSSDGYDYQKHADWFFEEIGKTPFIEEIFQHEIHYTSLIQCFDELSLGIIKP
LKVYVSYE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggaacaatataagttagttttagaaggtgcgaaacaacttaagtgggaaacaaatgaa
attaaggacatacaggacgatgaaattatcgttaaaacaatcgcaggatcgataagcatt
ggggccgagttaccacagtataatggatccgatgttacagatccgcatcctttttatcca
agaaaaactggatatgaaagttatggtgaagtgattgaagttggtaatcaagtaacacat
gtaaacgtaggtgataaagtagtttctttttatggacatgaaacgatagggatagttaag
gcgcataaagtaattcgagtgcctagttctatacaacctaaaattgctttattatctatt
ctttcatgtgatgccgctaaaggagtattgaaactaaacccgcgacaggatgaaaaagta
cttataattggaatgggagttattggtttactcgcttgttatttcttaaaatactatgta
ggcattgagcacgtggatgttgttgagcctaataaaaatagaagagattttgcaaagaag
tttggtacgaaaaacatatatgattcagaagagaaaataatagaaacatataattatggt
ttcgaatgttctgctacaaatagtgggttccatactttgcaaaaagctcttaaaactaat
ggtaaaatatgtatactgtctgatggtaatatagaagaactaacattaactgctaacttt
tatcagaaagaattgcaaattattggatcaagtgacggatacgattatcaaaaacatgca
gattggttttttgaagaaataggaaaaacaccatttatagaggagatctttcaacatgaa
atacattatacttcactcatacaatgctttgatgaattgagtttagggataattaaacca
ttaaaagtatatgtttcatatgaataa

DBGET integrated database retrieval system