KEGG   Bacillus cereus ATCC 14579: BC2777Help
Entry
BC2777            CDS       T00127                                 

Definition
(RefSeq) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00010  Glycolysis / Gluconeogenesis
bce00020  Citrate cycle (TCA cycle)
bce00620  Pyruvate metabolism
bce01100  Metabolic pathways
bce01110  Biosynthesis of secondary metabolites
bce01120  Microbial metabolism in diverse environments
bce01130  Biosynthesis of antibiotics
bce01200  Carbon metabolism
Module
bce_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC2777
   00020 Citrate cycle (TCA cycle)
    BC2777
   00620 Pyruvate metabolism
    BC2777
Enzymes [BR:bce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BC2777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N GCV_H FAM76 LIG3_BRCT
Motif
Other DBs
NCBI-GeneID: 1205125
NCBI-ProteinID: NP_832529
UniProt: Q81CI7
Position
complement(2749636..2750835)
Genome map
AA seq 399 aa AA seqDB search
MAVEVVMPKLGMAMKEGIITNWNIKAGDNVAKGELIASINSEKIETEIEAPADGTVLDIA
VSEDEGVPPGTVICYIGKPNEKVEMQESTHVVEEKTFNIEVQNVQNQEPNGKEVAKQRIK
ISPVAKKIAKSENLGIKVLVGTGPGGRITKADVLKALEVRGIVPEISEQEESNVIPVTGM
RKAIANRMHASLQNSAQLTLTMKVDVTDLVALHKEIAKVVQKRYDNKLTITDFVSRAAVL
ALGEHKEMNSAYIDDAIHQFEHVHLGMAVALEKGLIVPAIRFANNLSLVELSKEIKNVAQ
KARAGSLSSDDMHGTTFTISNLGSFGIEYFTPVLNTPETGILGIGAIEHVPVYKGKKLKK
GSMLPLSLTFDHRVLDGAPAAAFLRTIKHYLEEPITILL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggctgtagaagttgtaatgccaaagttaggtatggcgatgaaagaaggtattattacg
aactggaatattaaagcaggcgataatgtagcaaaaggagaactaattgctagtattaat
tcagaaaaaattgaaacggaaattgaagcgccagctgatggtacggtgcttgatatagct
gtaagtgaagatgaaggggtgccgcctggtactgtaatttgctacatcggtaaaccgaat
gaaaaagtagaaatgcaggaaagcacacatgtggtagaagaaaaaacatttaatatagaa
gtacaaaatgtacaaaatcaagaaccaaatgggaaagaagtagccaagcaaagaattaaa
atttcacctgtagcgaagaaaattgcaaagtctgaaaatttaggtatcaaggtgttagtt
ggtacaggtcctggcggaaggattacaaaggcagatgtattaaaagcacttgaggtaaga
ggaatcgttccggaaatatctgaacaagaagaaagtaacgtgattcctgttactggtatg
cgtaaagcgatcgcaaatcgtatgcacgcaagcttacaaaatagcgcacaattaacgtta
acgatgaaagtagatgtaacagatttagttgctttacataaagaaatagcgaaagttgta
caaaaaagatatgataataaattaaccattacggatttcgtctcgcgtgctgctgtatta
gcacttggagagcataaagaaatgaacagcgcttatatagatgatgcaattcatcaattt
gaacatgtgcatttaggcatggcagtcgcattagaaaaagggttaatcgttccagctatt
cgctttgcaaataatttatctttagtagaattgtctaaagagattaagaatgtggcacaa
aaggcgcgagcaggtagcttaagtagtgatgatatgcacggaacgacatttacaattagt
aatttaggtagctttggtattgaatatttcacacctgtattaaatacacctgagactggc
attttaggtattggcgcaattgaacatgttcctgtatataaagggaaaaaattaaaaaaa
ggtagtatgttacctttaagtttaacattcgatcatcgtgtactagacggtgcaccagca
gctgcatttttacgcacaattaaacattatttagaagaacctataacaattcttttataa

DBGET integrated database retrieval system