KEGG   Bacillus cereus ATCC 14579: BC3211Help
Entry
BC3211            CDS       T00127                                 

Definition
NADPH-cytochrome P450 reductase (EC:1.6.2.4)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bce00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bce00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bce00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(3189230..3192427)
Genome map
AA seq 1065 aa AA seqDB search
MEKKVSAIPQPKTYGPLGNLPLIDKDKPTLSFIKIAEEYGPIFQIQTLSDTIIVVSGHEL
VAEVCDETRFDKSIEGALAKVRAFAGDGLFTSETHEPNWKKAHNILMPTFSQRAMKDYHA
MMVDIAVQLVQKWARLNPNENVDVPEDMTRLTLDTIGLCGFNYRFNSFYRETPHPFITSM
TRALDEAMHQLQRLDIEDKLMWRTKRQFQHDIQSMFSLVDNIIAERKSSGDQEENDLLSR
MLNVPDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKNPDKLKKAYEEVDR
VLTDPTPTYQQVMKLKYMRMILNESLRLWPTAPAFSLYAKEDTVIGGKYPIKKGEDRISV
LIPQLHRDKDAWGDNVEEFQPERFEELDKVPHHAYKPFGNGQRACIGMQFALHEATLVMG
MLLQHFELIDYQNYQLDVKQTLTLKPGDFKIRILPRKQTISHPTVLAPTEDKLKNDEIKQ
HVQKTPSIIGADNLSLLVLYGSDTGVAEGIARELADTASLEGVQTEVVALNDRIGSLPKE
GAVLIVTSSYNGKPPSNAGQFVQWLEELKPDELKGVQYAVFGCGDHNWASTYQRIPRYID
EQMAQKGATRFSKRGEADASGDFEEQLEQWKQNMWSDAMKAFGLELNKNMEKERSTLSLQ
FVSRLGGSPLARTYEAVYASILENRELQSSSSDRSTRHIEVSLPEGATYKEGDHLGVLPV
NSEKNINRILKRFGLNGKDQVILSASGRSINHIPLDSPVSLLALLSYSVEVQEAATRAQI
REMVTFTACPPHKKELEALLEEGVYHEQILKKRISMLDLLEKYEACEIRFERFLELLPAL
KPRYYSISSSPLVAHNRLSITVGVVNAPAWSGEGTYEGVASNYLAQRHNKDEIICFIRTP
QSNFELPKDPETPIIMVGPGTGIAPFRGFLQARRVQKQKGMNLGQAHLYFGCRHPEKDYL
YRTELENDERDGLISLHTAFSRLEGHPKTYVQHLIKQDRINLISLLDNGAHLYICGDGSK
MAPDVEDTLCQAYQEIHEVSEQEARNWLDRVQDEGRYGKDVWAGI
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaaagtatctgccattcctcagccgaaaacatatggaccgctgggtaatctc
ccattaatcgataaagataaaccgaccctatcctttatcaagatagcggaagagtatggt
cccatttttcaaattcaaactttaagtgataccatcattgtcgtttctggacatgaattg
gtagcggaagtctgtgacgaaacacggttcgataaaagtatagagggtgctttagcaaaa
gttcgtgcctttgctggggacggattatttactagcgagactcacgagcctaactggaaa
aaagctcataatattttgatgcctacattcagccaacgggcaatgaaagattaccatgcc
atgatggtcgatattgctgtacaactcgttcaaaaatgggcacggcttaatccgaatgaa
aacgtagatgttccggaggatatgacacgtcttacgttagatacaattggtctatgtggt
tttaattaccgattcaatagcttttatcgtgagacacctcatccttttattactagcatg
acccgtgctctagatgaggcgatgcaccaattgcagcggctggatatagaagacaaactt
atgtggagaacgaaacgtcaatttcagcatgatatccaatctatgttttctttagtagat
aatattattgctgaacgtaaaagtagtggagatcaggaagaaaatgatttactttcccgt
atgttaaatgtgccagatccggaaactggtgaaaaattagatgatgaaaacattcgtttc
caaattattacttttttaatagctggacatgagacaacaagtggattgttatcttttgca
atttacttcttattaaagaatccggataaattgaaaaaagcctatgaagaagtagaccgt
gttttgacagatcctactccaacataccaacaagttatgaaactgaagtatatgcggatg
attttaaatgaatcgctacgtctatggcctaccgctccagcattcagtctttatgcaaaa
gaagatacagtgattggcgggaaatacccaattaagaaaggagaagatcgtatttctgtt
cttattccacagctacatagggataaagatgcatggggagacaatgtggaagaattccaa
cctgaacgatttgaagagctggataaggttcctcatcatgcttataagccatttggaaat
ggccagagagcatgtatcggtatgcaatttgcacttcatgaagccactcttgtaatggga
atgcttcttcaacattttgaattaatcgattatcaaaactatcagctggacgtaaaacaa
acattaacgctaaagcccggtgattttaagattaggattctaccccgaaaacaaactatt
agtcatcctactgttcttgcacctacagaggacaagctgaaaaacgatgaaattaagcaa
catgtccagaagacaccttctattattggggccgataatctttcacttcttgttctgtat
ggctcggatacaggtgtagcagaaggtattgcaagagaattagcagatacagctagttta
gaaggagttcaaacggaagtggtagctcttaacgatcgaattggaagtttgccaaaagaa
ggagcggtacttattgtgacttcttcttataatggaaaaccgccaagtaatgcagggcag
tttgtgcaatggttggaggaactaaaaccagatgagctaaaaggggttcaatacgcagtt
tttggttgtggagatcataattgggctagtacctaccaacggattccaagatacattgat
gagcaaatggctcaaaaaggagcaacaagattttctaaacgcggagaagcagatgcaagt
ggtgatttcgaggaacagcttgagcaatggaaacaaaacatgtggtctgatgcgatgaag
gcatttggattggagctcaacaaaaatatggaaaaagagcgcagtactttgagtctgcaa
tttgtcagtcgtcttggaggatctcctcttgcacgaacatatgaagcagtttatgcatct
atactagaaaatcgtgaacttcaatcatccagcagtgatagaagtacacgacatatcgag
gtatctttgccagaaggcgctacatataaagaaggagatcaccttggagtgttgccagtt
aatagcgagaaaaatatcaaccgaattttaaaacgttttggattaaatgggaaggatcaa
gttatactgagtgcaagtggacgaagtataaatcacatacctttagacagtcctgttagt
ttattggcccttcttagttatagtgttgaagttcaagaagctgccactcgagcacaaata
cgagaaatggtaacattcacagcatgtcctcctcataaaaaagaattggaagcattatta
gaagaaggagtttatcatgaacaaatattaaagaaacggatttcaatgttggaccttctt
gaaaagtatgaggcttgtgaaatccgatttgaacgctttttagaacttcttcctgcgctc
aaaccgcgttactattctatttcaagctctccactcgttgcacacaatcgtctgagcatt
acggtcggtgttgttaatgcgcctgcatggagtggggaagggacatatgaaggagtcgct
tctaattacttagctcagcgtcataataaagatgagattatctgtttcattcgaacgcca
caatcaaactttgaattacctaaagatccagaaacaccaattattatggttgggccaggt
actggaattgcaccattccgtggattcttgcaagcgcgtcgtgttcaaaagcaaaaaggt
atgaacttaggacaagcgcatctatattttggttgtcgtcatcctgaaaaagattatctc
tatcgtacagaattagaaaatgatgaaagagatggattaatctctttacacacagctttt
tctcgtctagagggacatccaaaaacatatgtacagcatttgataaaacaagatagaatc
aatttaatttcgttattagataatggagctcatctttatatatgtggtgatggaagtaaa
atggctccggatgtagaagataccctttgtcaagcatatcaagaaattcatgaagtcagt
gaacaagaagcaagaaattggttggatcgtgtgcaagatgaagggcgatatggaaaagat
gtttgggctggtatatga

DBGET integrated database retrieval system