KEGG   Bacillus cereus ATCC 14579: BC3211Help
Entry
BC3211            CDS       T00127                                 

Definition
NADPH-cytochrome P450 reductase (EC:1.6.2.4)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BC3211
  Amino acid metabolism
   00380 Tryptophan metabolism
    BC3211
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BC3211
Enzymes [BR:bce01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BC3211
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     BC3211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3189230..3192427)
Genome map
AA seq 1065 aa AA seqDB search
MEKKVSAIPQPKTYGPLGNLPLIDKDKPTLSFIKIAEEYGPIFQIQTLSDTIIVVSGHEL
VAEVCDETRFDKSIEGALAKVRAFAGDGLFTSETHEPNWKKAHNILMPTFSQRAMKDYHA
MMVDIAVQLVQKWARLNPNENVDVPEDMTRLTLDTIGLCGFNYRFNSFYRETPHPFITSM
TRALDEAMHQLQRLDIEDKLMWRTKRQFQHDIQSMFSLVDNIIAERKSSGDQEENDLLSR
MLNVPDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKNPDKLKKAYEEVDR
VLTDPTPTYQQVMKLKYMRMILNESLRLWPTAPAFSLYAKEDTVIGGKYPIKKGEDRISV
LIPQLHRDKDAWGDNVEEFQPERFEELDKVPHHAYKPFGNGQRACIGMQFALHEATLVMG
MLLQHFELIDYQNYQLDVKQTLTLKPGDFKIRILPRKQTISHPTVLAPTEDKLKNDEIKQ
HVQKTPSIIGADNLSLLVLYGSDTGVAEGIARELADTASLEGVQTEVVALNDRIGSLPKE
GAVLIVTSSYNGKPPSNAGQFVQWLEELKPDELKGVQYAVFGCGDHNWASTYQRIPRYID
EQMAQKGATRFSKRGEADASGDFEEQLEQWKQNMWSDAMKAFGLELNKNMEKERSTLSLQ
FVSRLGGSPLARTYEAVYASILENRELQSSSSDRSTRHIEVSLPEGATYKEGDHLGVLPV
NSEKNINRILKRFGLNGKDQVILSASGRSINHIPLDSPVSLLALLSYSVEVQEAATRAQI
REMVTFTACPPHKKELEALLEEGVYHEQILKKRISMLDLLEKYEACEIRFERFLELLPAL
KPRYYSISSSPLVAHNRLSITVGVVNAPAWSGEGTYEGVASNYLAQRHNKDEIICFIRTP
QSNFELPKDPETPIIMVGPGTGIAPFRGFLQARRVQKQKGMNLGQAHLYFGCRHPEKDYL
YRTELENDERDGLISLHTAFSRLEGHPKTYVQHLIKQDRINLISLLDNGAHLYICGDGSK
MAPDVEDTLCQAYQEIHEVSEQEARNWLDRVQDEGRYGKDVWAGI
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaaagtatctgccattcctcagccgaaaacatatggaccgctgggtaatctc
ccattaatcgataaagataaaccgaccctatcctttatcaagatagcggaagagtatggt
cccatttttcaaattcaaactttaagtgataccatcattgtcgtttctggacatgaattg
gtagcggaagtctgtgacgaaacacggttcgataaaagtatagagggtgctttagcaaaa
gttcgtgcctttgctggggacggattatttactagcgagactcacgagcctaactggaaa
aaagctcataatattttgatgcctacattcagccaacgggcaatgaaagattaccatgcc
atgatggtcgatattgctgtacaactcgttcaaaaatgggcacggcttaatccgaatgaa
aacgtagatgttccggaggatatgacacgtcttacgttagatacaattggtctatgtggt
tttaattaccgattcaatagcttttatcgtgagacacctcatccttttattactagcatg
acccgtgctctagatgaggcgatgcaccaattgcagcggctggatatagaagacaaactt
atgtggagaacgaaacgtcaatttcagcatgatatccaatctatgttttctttagtagat
aatattattgctgaacgtaaaagtagtggagatcaggaagaaaatgatttactttcccgt
atgttaaatgtgccagatccggaaactggtgaaaaattagatgatgaaaacattcgtttc
caaattattacttttttaatagctggacatgagacaacaagtggattgttatcttttgca
atttacttcttattaaagaatccggataaattgaaaaaagcctatgaagaagtagaccgt
gttttgacagatcctactccaacataccaacaagttatgaaactgaagtatatgcggatg
attttaaatgaatcgctacgtctatggcctaccgctccagcattcagtctttatgcaaaa
gaagatacagtgattggcgggaaatacccaattaagaaaggagaagatcgtatttctgtt
cttattccacagctacatagggataaagatgcatggggagacaatgtggaagaattccaa
cctgaacgatttgaagagctggataaggttcctcatcatgcttataagccatttggaaat
ggccagagagcatgtatcggtatgcaatttgcacttcatgaagccactcttgtaatggga
atgcttcttcaacattttgaattaatcgattatcaaaactatcagctggacgtaaaacaa
acattaacgctaaagcccggtgattttaagattaggattctaccccgaaaacaaactatt
agtcatcctactgttcttgcacctacagaggacaagctgaaaaacgatgaaattaagcaa
catgtccagaagacaccttctattattggggccgataatctttcacttcttgttctgtat
ggctcggatacaggtgtagcagaaggtattgcaagagaattagcagatacagctagttta
gaaggagttcaaacggaagtggtagctcttaacgatcgaattggaagtttgccaaaagaa
ggagcggtacttattgtgacttcttcttataatggaaaaccgccaagtaatgcagggcag
tttgtgcaatggttggaggaactaaaaccagatgagctaaaaggggttcaatacgcagtt
tttggttgtggagatcataattgggctagtacctaccaacggattccaagatacattgat
gagcaaatggctcaaaaaggagcaacaagattttctaaacgcggagaagcagatgcaagt
ggtgatttcgaggaacagcttgagcaatggaaacaaaacatgtggtctgatgcgatgaag
gcatttggattggagctcaacaaaaatatggaaaaagagcgcagtactttgagtctgcaa
tttgtcagtcgtcttggaggatctcctcttgcacgaacatatgaagcagtttatgcatct
atactagaaaatcgtgaacttcaatcatccagcagtgatagaagtacacgacatatcgag
gtatctttgccagaaggcgctacatataaagaaggagatcaccttggagtgttgccagtt
aatagcgagaaaaatatcaaccgaattttaaaacgttttggattaaatgggaaggatcaa
gttatactgagtgcaagtggacgaagtataaatcacatacctttagacagtcctgttagt
ttattggcccttcttagttatagtgttgaagttcaagaagctgccactcgagcacaaata
cgagaaatggtaacattcacagcatgtcctcctcataaaaaagaattggaagcattatta
gaagaaggagtttatcatgaacaaatattaaagaaacggatttcaatgttggaccttctt
gaaaagtatgaggcttgtgaaatccgatttgaacgctttttagaacttcttcctgcgctc
aaaccgcgttactattctatttcaagctctccactcgttgcacacaatcgtctgagcatt
acggtcggtgttgttaatgcgcctgcatggagtggggaagggacatatgaaggagtcgct
tctaattacttagctcagcgtcataataaagatgagattatctgtttcattcgaacgcca
caatcaaactttgaattacctaaagatccagaaacaccaattattatggttgggccaggt
actggaattgcaccattccgtggattcttgcaagcgcgtcgtgttcaaaagcaaaaaggt
atgaacttaggacaagcgcatctatattttggttgtcgtcatcctgaaaaagattatctc
tatcgtacagaattagaaaatgatgaaagagatggattaatctctttacacacagctttt
tctcgtctagagggacatccaaaaacatatgtacagcatttgataaaacaagatagaatc
aatttaatttcgttattagataatggagctcatctttatatatgtggtgatggaagtaaa
atggctccggatgtagaagataccctttgtcaagcatatcaagaaattcatgaagtcagt
gaacaagaagcaagaaattggttggatcgtgtgcaagatgaagggcgatatggaaaagat
gtttgggctggtatatga

DBGET integrated database retrieval system