KEGG   Bacillus cereus ATCC 14579: BC3341Help
Entry
BC3341            CDS       T00127                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BC3341
Enzymes [BR:bce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BC3341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3303264..3304421
Genome map
AA seq 385 aa AA seqDB search
MVKYISILGSTGSIGTSALDVVSAHPEHFKIVGLTANYNIDLLEQQIKTFQPRIVSVATK
DLADKLRTRISANTKITHGTDGFIAVATHPDSNLVLSSVVGVSGLLPTIEALKAKKDIAI
ANKETLVAAGHIVTELAKQNGCRLIPVDSEHSAIFQCLKGENNKEIEKLIVTASGGAFRD
KTRDEMQTLQAKDALKHPNWLMGAKLTIDSATLMNKGFEVMEARWLFDIPYKKINVMIHK
ESIIHSLVEFIDGSVMAQLGAPDMRMPIQYAFHYPTRLPSSYEKLNLLEIGSLHFEKPDL
EKFPCLQYAYECGKIGGTTPAVLNAANEIANALFLKNEIAFFDIEKTIYKTVEAHHNVKD
PSLDAILEADQWARQYANELLIKKR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaatatatatcaattttaggttcaacaggatccatcggcacatctgcattagat
gtcgtttcagctcatcctgaacattttaaaatcgtcggtttaaccgcaaattataatatc
gatcttcttgagcaacaaatcaaaacgtttcaacctcgtattgtaagcgttgcgacaaaa
gacttagcagacaagcttcgtacgcgtatttcagcaaatacaaaaatcacacacgggact
gatggcttcattgcagtagctactcaccctgattcaaatcttgtattaagctctgttgta
ggtgtttcaggattacttccaacaattgaagcattaaaagcgaagaaagatatcgctatt
gctaataaagaaactttggttgcagctggacatatcgtaactgaactagcgaaacaaaac
ggatgtcgcttaattccagtagatagtgagcattcagctattttccaatgtttaaaagga
gaaaataataaagagattgagaagttaattgtaacagcttccggtggtgctttccgtgat
aaaacacgtgatgaaatgcaaacattacaagcaaaagatgctttaaagcacccaaactgg
ttaatgggtgcaaaactaacgattgattctgccacattaatgaataaagggttcgaagta
atggaagcgagatggctatttgatattccatataaaaaaattaatgtaatgattcataaa
gaaagtatcattcattctttagtagaatttattgatggatcagttatggcacagctcggt
gctcctgatatgagaatgccgattcaatatgcgtttcactatcctactcggctaccttct
tcctatgaaaaattaaatttattagaaatcggtagtttacattttgaaaaaccagattta
gagaagttcccttgtctacaatacgcatatgaatgtggcaaaatcggtggtactactccc
gctgtattaaatgcagcaaatgaaattgcgaatgcgctattcttaaaaaatgaaattgcc
tttttcgatattgaaaaaacaatttacaaaacagttgaagctcatcataacgtaaaagat
ccttcactagatgctatattagaagcggatcaatgggcacgccaatatgcaaatgaattg
ttaataaaaaagcgctaa

DBGET integrated database retrieval system