KEGG   Bacillus cereus ATCC 14579: BC3745Help
Entry
BC3745            CDS       T00127                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00010  Glycolysis / Gluconeogenesis
bce00260  Glycine, serine and threonine metabolism
bce00680  Methane metabolism
bce01100  Metabolic pathways
bce01110  Biosynthesis of secondary metabolites
bce01120  Microbial metabolism in diverse environments
bce01130  Biosynthesis of antibiotics
bce01200  Carbon metabolism
bce01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC3745
  Energy metabolism
   00680 Methane metabolism
    BC3745
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BC3745
Enzymes [BR:bce01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BC3745
Membrane trafficking [BR:bce04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BC3745
Exosome [BR:bce04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BC3745
  Exosomal proteins of melanoma cells
   BC3745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF1482
Motif
Other DBs
NCBI-GeneID: 1206090
NCBI-ProteinID: NP_833470
UniProt: Q81A46
Position
complement(3708624..3709199)
Genome map
AA seq 191 aa AA seqDB search
MSTYIYMVRHGESPKLEGNERMRGLTERGHMDARRVTDILKAERIDTFISSPYNRAMLTI
EESANFHEKEIVVYENLKECMFSSEDQVISDKEVYPLVQKMFSNPDFARTEGESYADCQR
RVVKVLKEILMDFRGCKIVIGTHGLVMTLMMNYFDKQYGFEFLMNTSKPDIYKMEFKEEQ
LMNVERLWKAE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgagcacatatatttatatggttagacatggtgaatcaccaaaactagaaggaaatgaa
agaatgcgtggattaactgagaggggacatatggatgcccgtagagtaactgacatatta
aaagcggagaggattgatacttttatttccagtccttataatcgggctatgctaacgata
gaggagtcagctaatttccatgaaaaagaaatagtagtatatgaaaatcttaaagagtgt
atgttttcaagtgaggatcaggttatatcagacaaagaggtgtatccacttgtacagaag
atgttctctaatccggactttgcacgaacggaaggagagtcatatgcagattgccagaga
agagtagtgaaagtattaaaagaaatcttaatggattttcgaggatgcaaaattgtaatt
ggtacacatgggcttgtcatgacattaatgatgaactattttgataaacaatatggtttt
gaatttttaatgaatacgtcaaaaccggatatatataagatggaatttaaagaagaacaa
ttaatgaatgtagagagattatggaaagctgaataa

DBGET integrated database retrieval system