KEGG   Bacillus cereus ATCC 14579: BC3760Help
Entry
BC3760            CDS       T00127                                 

Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC3760
Enzymes [BR:bce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BC3760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3723036..3724322)
Genome map
AA seq 428 aa AA seqDB search
MEVYTMKFPHDFLFGAASASYQVEGAWNEDGKGVTNWDEFSKIPGKTYNGTNGDVAVDHY
HRYKEDVRLMAEMGLESYRFSISWARILPTGDGKVNEKGIEFYNNLIDECLKYGIVPFVT
LYHWDLPLPLEKDGGWTNKRTAEAFVKYAETCFKAFGDRVKHWITFNETVMFCGLGYLKG
AHPPGIQNDVPKYFQATHYVFYAHAKTVAVYKQLKQYGEIGITHVFLPAYSVDDQKENIQ
AANHANEYETYWYYDPILKGEYPSYVVQQLKEKGWTPNWTVEELEIIKQNAEENDFIGLN
YYQPIRVERYDMDIKSEEHSRENSTLAPGNPSFDGFYRTVKMDDKTYTKWGWEISPEGFL
EGLHMLKARYGDIKMYVTENGLGDEDPIIDGEIVDVPRIKFIEAHLKVMKRAIEEGINLK
RLLCMVSD
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggaggtatatactatgaagtttccacatgattttttattcggagctgcttcagcttct
tatcaagtagaaggtgcatggaatgaagatggaaaaggtgttacgaattgggacgagttt
tcaaaaattcctggcaaaacatacaatggaacaaatggtgatgtagctgttgatcattat
catcgatataaggaagatgttcgcttaatggctgagatgggattagaatcgtatcgtttt
tctatttcttgggcgagaatattgccgactggagatggaaaggtaaatgaaaaagggatt
gaattttataacaacttaattgatgaatgtttaaaatacgggattgtgccgtttgtcact
ttatatcattgggatttaccattaccgttagaaaaagatggtggatggacgaataaaaga
acagcagaggctttcgtaaaatatgcagaaacttgttttaaggcatttggtgacagagtt
aagcattggattacttttaatgagaccgtaatgttttgtggattaggttatttaaaaggt
gcacatccaccaggaatacaaaatgatgttccaaagtattttcaagcgactcattatgta
ttttatgcacacgcgaaaacagttgcggtgtacaagcagctgaaacaatatggtgagatt
gggattacacatgttttcttaccagcttatagtgtggatgatcaaaaagaaaatatacaa
gcagcaaatcatgcgaatgaatatgaaacgtattggtattatgatccaattttaaaaggc
gagtatccgtcttatgttgtacaacaattaaaggaaaaaggatggactcctaattggacg
gttgaagaattagaaatcattaaacaaaatgcagaagaaaatgattttattggcttgaat
tattatcaaccaatacgagtagaaagatacgatatggatataaagagtgaggaacattct
cgagaaaactcaacgcttgctccaggtaacccttcttttgatggtttttatcgaacagtt
aaaatggatgataaaacatatacaaaatggggatgggaaatatctcccgaaggtttctta
gagggattgcatatgttgaaagcgcgttacggtgacataaagatgtatgtaacggaaaat
ggacttggtgatgaagatccaatcattgacggagaaattgtagatgttccgagaattaaa
tttattgaagcgcatttaaaagtaatgaagcgtgcaattgaagagggaattaacttaaaa
aggttattatgcatggtcagtgattga

DBGET integrated database retrieval system