KEGG   Bacillus cereus ATCC 14579: BC3834Help
Entry
BC3834            CDS       T00127                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC3834 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BC3834 (sucC)
   00640 Propanoate metabolism
    BC3834 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BC3834 (sucC)
Enzymes [BR:bce01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BC3834 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3813235..3814395)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQGKAVLRSYGVSVPNGKVAFTVEEAVEAAKELGTDVCVEKAQIHAGGRGKAGGV
KVAKNLDEVRTYAESILGTTLVTHQTGPEGKEVKRLLIEEGCDIKKEYYVGLVLDRATSQ
VVLMASEEGGTEIEEVAEKTPEKIFKEYIDPAVGLQGFQARRIAFNINIPKELVGQAVKF
MMGLYRAFIEKDCSIAEINPLVTTGEGKVMALDAKLNFDSNALYRHKDILELRDLDEEDS
KEIEASKYDLNYIPLDGNIGCMVNGAGLAMATMDIIKHYHGDPANFLDVGGGATAEKVTE
AFKIILSDKNVKGIFVNIFGGIMKCDVIAEGVIEATKQVGLELPLVVRLEGTNVELGKKI
LNESGLNIVAAESMADGAQKIVSLVG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccaaggtaaggcagtccttagaagctatggggttagcgttccg
aacgggaaggttgcgtttacagtagaagaagctgtagaagcagcgaaagaattaggaaca
gatgtatgtgtagagaaagcacaaattcacgctggtggacgcggcaaagctggcggagta
aaagttgcgaaaaatttagatgaagttcgtacatatgcagaaagcattttaggaactaca
cttgtgacacatcaaacaggtcctgaaggtaaggaagtaaaacgcttacttatcgaagaa
ggttgcgatattaaaaaagaatattatgtaggtctagttttagaccgtgcaacttctcaa
gttgttttaatggcgtctgaagaaggcggaacagaaattgaagaagtagcagaaaaaaca
cctgaaaaaatctttaaagaatatattgatccagcagtaggcttgcaaggtttccaagcg
cgccgaattgcatttaacatcaatattccaaaagagcttgtaggacaagctgtgaagttt
atgatgggcttatatcgtgcgtttatcgaaaaagattgctctatcgctgagattaaccca
cttgttacaacaggcgaaggtaaagttatggcattagatgcaaaattaaactttgattct
aatgcgttatatcgccataaagacattttagagcttcgtgatcttgatgaagaggattca
aaagaaattgaagcttcaaaatacgacttaaactacattcctttagatggaaatatcggt
tgtatggttaatggtgcaggtttagcgatggctacaatggatatcattaaacattaccac
ggtgacccagctaacttcttagatgttggtggcggtgcaactgcagaaaaagttacagaa
gcattcaaaattatcctttctgacaaaaatgtaaaaggtatcttcgttaacatttttggt
ggcattatgaagtgtgatgttattgcagaaggtgttattgaagcaacgaaacaagtaggt
cttgagttacctttagttgtacgtcttgaaggcacaaacgtagaactaggtaagaaaatt
ttaaatgagtctggcttaaatattgttgcagcagaatctatggcagacggtgcacaaaaa
attgtttcactagtgggctaa

DBGET integrated database retrieval system