KEGG   Bacillus cereus ATCC 14579: BC3914Help
Entry
BC3914            CDS       T00127                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bce00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bce00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(3895224..3896699)
Genome map
AA seq 491 aa AA seqDB search
MKLHTLVSCLHDFPVVPKENPEITSIEADSRKVKEGSLFVCMKGYTVDSHDFAKQAAAQG
AAAIVAERPIDVDVPVVLVKNTFRSLAVLADYFYGQPTHKLHLIGITGTNGKTTTSHIMD
EIMRAHGHKTGLIGTINMKIGDETFEVKNTTPDALTLQQTFSKMVEQGVDSTVMEVSSHA
LDLGRVHGCDYDVAVFTNLTQDHLDYHKTMEEYKHAKGLLFAQLGNSYNHNREKYAVLNS
DDNVTEEYMRSTAATVVTYGIDTTSDIMAKNIVMTSGGTTFTLVTPYESVNVTMKLIGKF
NVYNVLAATAAGLVSGVKLETIIAVIKDLAGVPGRFEVVDGGQNYTVIVDYAHTPDSLEN
VLKTAKQFAKGDVYCIVGCGGDRDRTKRPIMASVATKYATHAIYTSDNPRSEDPAAILDD
MVHGASGKNYEMIIDRKEAIHHAIAKAKADDIIIIAGKGHETYQIIGKEVHHFDDREVAK
EAITGRLNNEE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgcatacacttgtatcatgtttgcatgattttccagttgttccaaaagaaaat
ccagaaatcacatctatagaagctgattcacgtaaagtgaaagagggaagcttatttgta
tgtatgaaaggatatacggttgatagccatgattttgctaagcaagcagcggcacaagga
gcggctgctattgttgcggaaagaccaattgatgttgacgttccagttgtacttgtgaaa
aatacttttcgttcgttagcggttttagctgattatttttatggtcaaccgacacacaag
ttacatttaatcggaattacaggtacaaatggaaagacaacaacatcgcatattatggat
gagattatgcgagcacatggtcataaaacagggctaattggaacgattaatatgaaaatc
ggtgatgaaacatttgaggtgaaaaatacaacaccagatgcactaacacttcaacagacg
ttttcaaaaatggttgaacaaggtgtggacagcacggtaatggaagtttcgtcacatgcg
ttagatcttggtcgtgtacacggatgtgattacgatgtagcggtgtttacgaatttaacc
caagatcatttagactatcataaaacgatggaagaatataaacatgcaaaagggttacta
tttgcacagcttggcaatagttataatcataatcgtgaaaagtacgctgtgctcaatagc
gatgataatgtaacagaagagtatatgagaagtactgcagcaacagttgtaacatatggt
attgatacaacaagtgatattatggcaaaaaatatcgttatgacgagtggcgggactaca
tttacgcttgtcacaccatatgaaagtgtaaatgttacgatgaaattaataggtaaattt
aatgtatataacgtacttgcagcaacagcagcaggacttgtttcgggtgtgaaattagaa
acaatcattgctgttataaaggatttagctggggttccaggacgttttgaagttgttgat
ggagggcaaaattatacagttattgttgattacgcacatacgccagatagtttagaaaat
gtattaaaaactgcaaaacaatttgcaaaaggtgatgtgtattgtatcgttggttgtggt
ggcgatagggaccgaacgaagagaccgataatggcaagtgttgcaacaaaatatgcaact
catgcaatttatacatcagataatccaagaagtgaagatccagcggctattttagatgat
atggtacatggtgcaagcgggaaaaattatgaaatgatcattgatagaaaagaagcaata
caccatgcaatcgctaaagcgaaagcagatgatatcattattattgctggtaaggggcat
gaaacgtatcaaattattggtaaagaagttcatcatttcgatgatcgtgaagttgctaaa
gaagcaattacagggcgtttaaacaacgaagagtaa

DBGET integrated database retrieval system