KEGG   Bacillus cereus ATCC 14579: BC4030Help
Entry
BC4030            CDS       T00127                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bce00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bce00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
4004571..4005254
Genome map
AA seq 227 aa AA seqDB search
MITDRLEERAKEAAEQLQNEGFQAIGLKCDVTSEEEITAAISQTVDHFGSLHILINNAGM
QHVSPIEDFPTEKFELLIQIMQIAPFIAIKHAFPIMKQQKYGRIINVASINGLVGFAGKA
AYNSAKHGVIGLTKVAALEGATHGITVNALCPGYVDTPLVRNQLQDLATTRNVPLENVLE
DVIYPLVPQKRLLQVQEIADYAMFLASEKAKGITGQAVVIDGGYTAQ
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gtgattaccgatcggcttgaagaacgtgcaaaagaagctgctgaacaattacaaaatgaa
ggttttcaagctatcggtttaaaatgtgacgttacatctgaagaggaaattacagcagca
atttctcaaacagttgatcatttcggttcattacatatattaattaacaacgcaggaatg
caacacgtttcacccattgaagactttccaactgaaaagttcgagctactaattcaaatt
atgcaaattgctccgtttattgcaattaagcatgcctttccgattatgaaacaacaaaaa
tatggtcgtattattaatgtcgcttctattaacggccttgtcgggtttgctggaaaagct
gcctacaatagtgcaaaacatggcgtaattggattaacaaaagttgccgctttagaaggt
gctacgcatggtattactgttaatgccctttgccctggttatgttgataccccccttgta
cgtaatcaactacaagacttagctactacacgaaatgtaccacttgaaaatgttttagaa
gatgttatttatccactcgttccacaaaagcgcttattacaagtacaagaaattgcagat
tatgcgatgtttttagcgagtgaaaaagctaaaggtataactggtcaagctgtcgttatc
gatggtggttataccgctcaataa

DBGET integrated database retrieval system