KEGG   Bacillus cereus ATCC 14579: BC4039Help
Entry
BC4039            CDS       T00127                                 

Definition
2-hydroxy-3-oxo-5-methylthiopent-2-enoate oxidase (EC:1.-.-.-)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BC4039
Enzymes [BR:bce01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     BC4039
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     BC4039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
4012859..4013371
Genome map
AA seq 170 aa AA seqDB search
MAQIRIHEVNTRIENEVEVSKFLQEEGVLYEKWNISKLPTHLNENYSLTDENKAEILAIF
SKEIADVSARRGYKAHDVISLSSSTPNLDELLINFQKEHHHTDDEVRFIVSGHGIFAIEG
KDGKFFDVELEPGDLISVPENARHYFTLQDDRQVVAIRIFVTTEGWVPIY
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaattcgtattcatgaagtaaatactcgtattgaaaatgaagtggaagtatct
aaatttctacaagaggaaggcgttttatatgagaaatggaatatttctaaacttcctact
catttaaatgaaaattattcgttaacagatgaaaacaaagctgaaatattagctattttt
tcaaaagaaatcgctgatgtttcagcacgtcgaggttataaagcacatgatgtaatctca
ctttcaagtagcacacctaaccttgacgaattattaattaatttccaaaaggaacaccat
catacagatgacgaagttcgctttatcgtcagtggtcacggcattttcgctattgaaggt
aaagatgggaaattctttgatgttgaacttgagccaggcgatttaatatctgttcctgaa
aatgcaagacattattttaccttgcaagatgatcgccaagttgtagctattcgtattttt
gtgacaactgaaggctgggttccaatctattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system