KEGG   Bacillus cereus ATCC 14579: BC4365Help
Entry
BC4365            CDS       T00127                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BC4365
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC4365
   00620 Pyruvate metabolism
    BC4365
   00650 Butanoate metabolism
    BC4365
  Lipid metabolism
   00071 Fatty acid degradation
    BC4365
  Amino acid metabolism
   00350 Tyrosine metabolism
    BC4365
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BC4365
   00626 Naphthalene degradation
    BC4365
Enzymes [BR:bce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BC4365
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BC4365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(4303425..4306028)
Genome map
AA seq 867 aa AA seqDB search
MVVKEKVVNEMQEVKKMIDTLVNNGQQALQALESFTQEEIDNIVHEMALAGVDQHMPLAK
LAVEETGRGVYEDKCIKNIFATEYIWHSIKQDKTVGIIHEDSHEEIIEIAEPVGVVAGVT
PVTNPTSTTMFKALIAIKTRNPIIFAFHPSAQKCSVAAAKTVYDAAMKAGAPKHCIQWIE
RPSVEATKQLMNHDGVALVLATGGAGMVKSAYSTGKPALGVGPGNVPCYIEKSAHVKRAV
NDLILSKTFDNGMICASEQAIIVDKEIYDDVKTEMIENNCYFVTEEERKKLEKLVINENT
CAVNSDIVGKSAQYIADLVGITVPEHTKMLVAEIQGIGAAYPLSREKLSPVLACVKANSL
EEGFTYCEEMLNLGGLGHSAVIHSTNKDVQKQFGLRMKACRLIVNAPSSQGGIGDIYNGF
IPSLTLGCGSYGKNSVSQNVTATHLLNIKRLANRKKNMQWFKLPPKIYFEKHATAYLANM
PNISRAFIVTDPGMVEHGYVDTVAHYLNKHANDVKVEVFFEVEPDPSDETVFKGAEMMRS
FKPDVIIALGGGSAMDAAKGMWLFYEHPETTFYGIKQKFLDIRKRTCKYPELGNKAQFVA
IPTTSGTGSEVTPFAVITDKKNNIKYPLADYELTPDVAIVDPQFVMTVPPHVTADTGMDV
LTHAIEAYVSVMANDYTDGLALKAIDLVFKYLPRAYKDGNDEEAREKMHNASAIAGMAFA
NAFLGINHSLAHKIGPEFHIPHGRANAILMPHVVRYNAIKPRKHALFPKYEHFVADERYA
HIARMLGLPASSAAEGVESLVKAIIELGKSLNINMSIAGQGVDKEQFEEVVGVLAERAFE
DQCTTANPKLPLISELKEIYMKAYKGE
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atggtagtcaaagagaaagttgtaaatgaaatgcaggaagtaaaaaagatgattgataca
ctagtaaataatggtcaacaagctttacaagcattagaaagttttacacaagaggaaatt
gacaacattgttcatgaaatggcattagcaggtgttgatcaacatatgccgctagcaaaa
ttggcagttgaagaaactggccgtggtgtatatgaagacaaatgcattaaaaatattttt
gccactgaatatatttggcatagtataaaacaagataaaacggtaggaattattcacgaa
gattctcatgaagaaataatagaaatcgcggaacctgtcggtgtagtagctggggtaaca
ccagtaacgaatccaacgtcgacaacaatgtttaaagcgttaattgcgataaaaacaaga
aatccaattattttcgcgtttcatccttccgcacaaaaatgttctgtggcagcggcgaaa
acagtatatgatgcagcgatgaaagctggtgcaccaaaacactgtattcaatggattgaa
agaccgtctgttgaagcgacgaaacaattaatgaaccatgatggtgtagcactcgttcta
gcaactggaggcgctggtatggtgaaatcagcttactctactggaaaaccagcgttaggc
gttgggcctggtaatgtaccgtgttatatagaaaaatcagcacatgtaaaacgagctgtt
aatgatttaattttatcgaaaacatttgataacggtatgatttgtgcatcggaacaagca
atcattgtcgataaagaaatctatgatgatgttaaaacagaaatgattgaaaacaattgt
tactttgtaacagaagaagaaagaaaaaaattagaaaagcttgttataaatgaaaataca
tgtgcagtaaatagtgatattgtagggaaatcagcacagtatattgccgatttagttggg
attactgttcctgaacatacaaaaatgcttgtagctgaaattcaaggtatcggagcagca
tatccgttatctcgtgagaaactgagtccagtattagcttgtgtgaaggcgaattcatta
gaagaaggatttacatattgcgaagaaatgttgaacctaggtggtttaggacattcagca
gttatccattctacaaataaagatgtgcaaaagcaatttgggttacgtatgaaagcttgc
cgtctcattgtaaatgcaccttcatcacaaggtggaataggggatatatataatggattt
attccatcacttacacttggttgtggttcatacggaaagaattcagtttcccaaaatgta
acagccactcatttattaaatataaaaaggctggcaaatagaaaaaagaatatgcagtgg
ttcaaattgccaccaaaaatttattttgaaaaacatgctacagcttatttagcaaatatg
cctaacatttcacgtgcatttattgtaacggaccctggaatggttgaacatggctatgtc
gatacagtcgcgcactatttaaacaagcatgcaaatgatgtgaaagttgaagttttcttt
gaggtcgaaccagatccatcagatgaaactgtttttaaaggtgcggaaatgatgagaagc
tttaagccagatgtaattatcgcacttggtggtggttcagctatggatgcagcaaaagga
atgtggttattctatgagcatccagaaacgacattctatggcattaaacagaagttttta
gatataagaaaacgtacatgtaaatatccggaattaggaaataaggcgcagtttgttgcg
attccaacgacatcaggaacgggatcagaagtgacaccatttgcggttattacagataag
aaaaataatataaagtatccgcttgcagattatgaattaacaccagatgtagcaattgtt
gatccgcaatttgtaatgacagtaccaccacatgtaacagcagatactggtatggatgtt
ttaacacatgcaattgaggcgtatgtgtctgttatggcaaatgactatacagatggatta
gcattaaaagctattgatctcgtattcaaatatttaccgagagcatataaagatggaaat
gatgaagaagcaagagaaaaaatgcataacgcttctgcaattgcaggtatggcatttgca
aatgctttcctcggtattaatcacagcttagcacataaaattggaccagaattccatatt
ccgcacggacgcgcaaatgccattctaatgccgcatgtagtccgctataatgctattaag
ccaagaaaacacgcattgttcccaaaatatgagcactttgtggcagatgaaagatatgca
catatagcgagaatgctcgggcttccagcaagctcggcagcagaaggggtggaatcactc
gtcaaagcaattattgagcttggaaaaagcttaaatattaatatgagtattgcaggacaa
ggagtagataaagagcaatttgaagaggttgttggagtattagcagaaagagcttttgaa
gatcaatgtacaactgctaatccaaagttgccgcttatttcagaactgaaagaaatttat
atgaaagcatataaaggtgaataa

DBGET integrated database retrieval system