KEGG   Bacillus cereus ATCC 14579: BC4415Help
Entry
BC4415            CDS       T00127                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bce00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BC4415 (ruvA)
Enzymes [BR:bce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BC4415 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(4356329..4356946)
Genome map
AA seq 205 aa AA seqDB search
MFEYVTGYVEYVGPEYVVIDHNGIGYQIFTPNPYVFQRSKQEIRVYTYHYVREDIMALYG
FKTREERLLFTKLLGVSGIGPKGALAILASGQTGQVVQAIEHEDEKFLVKFPGVGKKTAR
QMILDLKGKLADVVPDAFVDLFSDTERFDEKKGSSAELDEALEALRALGYAEREVSRVVP
ELLKESLTTDQYIKKALSLLLNGKR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgaatatgttacaggttacgtggagtatgtagggccggaatatgtcgtaattgat
cataatggaattggttatcaaattttcacaccaaatccgtatgtatttcaaagaagtaag
caagaaatccgtgtctatacatatcattatgtgagagaagatattatggcactttacggg
tttaaaacacgtgaagagcgtttattatttacaaagttgttaggcgtgtctggcattggg
ccaaaaggagctcttgcaattttagcttctggtcaaacaggacaggtcgttcaagcgatt
gagcatgaagatgagaagtttttagtgaaattcccaggcgtcggaaagaaaacagcacgc
caaatgattttagatttaaaaggaaaactagcagatgtcgtaccagatgcatttgttgat
ttattctcagacacagaacgttttgatgagaagaaaggttcatcagctgagcttgatgag
gcactggaagctctccgcgcacttggatacgcagaacgcgaagtttctcgtgttgtacca
gagttattaaaagaatcattaacgacggatcagtatattaaaaaggcacttagtctttta
ctaaatggtaagaggtga

DBGET integrated database retrieval system