KEGG   Bacillus cereus ATCC 14579: BC4524Help
Entry
BC4524            CDS       T00127                                 

Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BC4524
  Lipid metabolism
   00071 Fatty acid degradation
    BC4524
Enzymes [BR:bce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BC4524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(4468603..4469379)
Genome map
AA seq 258 aa AA seqDB search
MLKFLSVRVEDHIAVATLNNAPANAMSSQVMHDVTELIDQVEKDDNIRVVVIHGEGRFFS
AGADIKEFTSVTEAKQATELAQLGQVTFERVEKCSKPVIAAIHGAAMGGGLEFVMSCHMR
FATESAKLGLPELTLGLIPGFAGTQRLPRYVGKAKACEMMLTSTPITGAEALKWGLVNGL
FSEESLLDDTLKVAKQIAGKSPATTRAVLELLQTTKSSHYYEGVQRESQIFGEVFTSEDG
REGVAAFLEKRKPSFSGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaattcctatctgtaagagttgaagatcatatcgcggtggcgacgttaaataac
gcaccagcgaatgcgatgtcttcacaagttatgcatgacgttactgaattaattgatcaa
gtggaaaaggatgataacattcgtgttgttgttattcacggtgaaggacgtttcttctca
gcaggagcagatattaaagaatttacatctgttactgaagcgaagcaagcaacagaatta
gcacagcttggacaagttacgtttgagcgtgttgaaaaatgttcaaaaccagttattgcg
gcaattcatggagcggcaatgggcggcggccttgagtttgttatgtcttgccacatgcgc
tttgcaactgaaagtgcaaaacttggtttacctgaattaacacttggattaattcctggc
tttgcaggtacacagcgcttaccacgttatgttgggaaagcgaaagcttgtgaaatgatg
ttaacaagtacaccaattactggtgcagaagcattaaagtggggacttgttaacggattg
ttctctgaagaatctcttttagatgatacgcttaaagttgcaaaacaaattgctggaaaa
agtccagcaacaactcgtgctgtactagagttattgcaaacgacaaaatcgtctcattac
tatgaaggtgtacaacgtgaatcacaaatttttggtgaagtatttacgagtgaagatgga
agagaaggtgtagccgcatttttagaaaagcgtaaaccttcatttagtggcaggtag

DBGET integrated database retrieval system