KEGG   Bacillus cereus ATCC 14579: BC4659Help
Entry
BC4659            CDS       T00127                                 

Definition
(RefSeq) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00010  Glycolysis / Gluconeogenesis
bce00620  Pyruvate metabolism
bce00640  Propanoate metabolism
bce00680  Methane metabolism
bce01100  Metabolic pathways
bce01110  Biosynthesis of secondary metabolites
bce01120  Microbial metabolism in diverse environments
bce01130  Biosynthesis of antibiotics
bce01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC4659
   00620 Pyruvate metabolism
    BC4659
   00640 Propanoate metabolism
    BC4659
  Energy metabolism
   00680 Methane metabolism
    BC4659
Enzymes [BR:bce01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BC4659
Lipid biosynthesis proteins [BR:bce01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BC4659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C FPRL1_inhibitor
Motif
Other DBs
NCBI-GeneID: 1207004
NCBI-ProteinID: NP_834365
UniProt: Q817A0
Position
complement(4600663..4602381)
Genome map
AA seq 572 aa AA seqDB search
MKVETLPVIKGENNLPNYDEAYANFNWEEVNKNFTWNETGRVNMAYEAIDKHAKSDRKNK
VALYYQDGSRKEKYTFKEMKDFSNKAGNVLKNYGDVEKGDRVFIFMPRSPELYFALLGAV
KLGAIVGPLFEAFMEGAVRDRLEDSEAKVLITTPELLERVPLNDLPALKTVFLVGDNVEE
GGKTVAFNPLFEQASKELHIEWLGREDGLILHYTSGSTGKPKGVLHAQNAMVQHYQTAKW
VLDLKEDDVYWCTADPGWVTGTAYGIFAPWLVGASNVILGGRFSPEAWYEALQDYGVTVW
YSAPTAFRMLMGAGQDAIKKYDLSQVRHVLSVGEPLNPEVIRWGMNAFGLRIHDTWWMTE
TGGQVICNYPCMEIRPGSMGKPIPGVKAAIVDNEGNEVPPYTMGNLAIAKGWPSMMRGIW
NNQQKYESYFMPGDWYVSGDSAYMDEDGYFWFQGRIDDVIMTSGERVGPFEVESKLIEHA
AVAEAGVIGIPDPVRGEIIKAFIALRAGYEPSDELKEEIRQFVKKGLAAHAAPRQIEFRD
KLPKTRSGKIMRRVLKAWELNLPTGDLSTMED
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagaaacgcttcctgtcattaaaggagaaaataatttgccgaattatgatgag
gcatacgcgaattttaactgggaagaggttaataaaaactttacttggaatgaaacaggc
cgagtaaatatggcgtatgaggcaattgataagcatgcgaaatccgatcgaaagaataaa
gtagctctttattatcaagatggatcgcgaaaagagaaatatacatttaaggaaatgaag
gatttttctaataaagcaggaaacgtccttaagaattatggcgatgtagaaaaaggcgat
cgcgtttttatttttatgccacgttctccagagttatatttcgcacttttaggtgcagtg
aaattaggagcaattgttggaccgctatttgaagcatttatggaaggcgcagttcgcgat
cgcttagaagatagcgaagcaaaggtgttaattacaacgcctgaattattagagcgcgta
ccattaaatgatttaccggctttaaaaacagttttccttgttggagataatgtagaagaa
ggcggtaaaacggtagcgttcaatccgttatttgaacaagcttcaaaagaattacatatt
gaatggttaggccgtgaagacggtttgattctacattacacgtctggttctactggtaag
ccaaaaggtgtgcttcatgcgcaaaacgcaatggttcagcactatcaaacggcgaagtgg
gtattagatttaaaagaagacgatgtatattggtgtactgctgacccgggctgggtaact
ggaacagcttacggtattttcgcaccgtggttagttggagcgtcaaatgttattttaggt
ggacgctttagtccagaagcttggtatgaagcactgcaagattacggtgtgacggtttgg
tacagcgcaccaacagcattccgtatgttaatgggagctggacaagacgcaattaaaaaa
tatgacttatcacaagttcgtcacgtattaagcgttggtgagccgttaaatccagaagta
attcgctggggtatgaatgcatttggacttcgtattcatgatacgtggtggatgacagaa
acaggtggacaagtaatttgtaactacccttgtatggaaatccgtccaggttcaatgggt
aaaccaattccaggtgtgaaagcagcgattgttgataatgaaggaaatgaagtgcctcct
tacacaatgggtaacttagcaattgcgaaaggttggccatctatgatgcgcgggatctgg
aataaccagcaaaaatatgaatcttatttcatgccgggagattggtacgtatcaggtgac
tctgcttatatggatgaagatggatacttctggttccaaggacgtattgacgatgtaatt
atgacgtcaggtgagcgcgttggtccgtttgaagtagaaagtaaattaatcgagcatgct
gctgttgcagaagctggtgtaattggtattcctgatccggtgcgcggcgaaattattaaa
gcatttatcgcacttcgagcaggatacgaaccatctgatgaattaaaagaagaaattcgt
caatttgtaaagaaaggcctagcagctcatgcagcgccacgacaaattgaatttagagat
aaattaccgaaaacgagaagtggtaaaattatgcgccgcgtattaaaagcgtgggagctg
aatttaccaacaggtgacttatcaacgatggaagattaa

DBGET integrated database retrieval system