KEGG   Bacillus cereus ATCC 14579: BC4702Help
Entry
BC4702            CDS       T00127                                 

Definition
(RefSeq) dipeptidase PepV
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00300  Lysine biosynthesis
bce01100  Metabolic pathways
bce01120  Microbial metabolism in diverse environments
bce01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BC4702
Enzymes [BR:bce01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BC4702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 1207046
NCBI-ProteinID: NP_834406
UniProt: Q816W3
Position
complement(4639421..4640827)
Genome map
AA seq 468 aa AA seqDB search
MSAINWTEEVAKRKDDLIRDTQQFLQIKSVWEEESAKEGAPFGEGVEKALSFMLHKGETE
GFTSKNLEGYAGHLEMGQGEELVGILCHVDVVPEGDGWTTPAYSADIRDGKIFARGAIDD
KGPTMAAYYAMKIVKELGLPLSKRVRMIIGTDEESNWKCVDHYFKNEEMPTIGFAPDADF
PIINAEKGISDIQVVQNGSEEKKGTYELVSFDSGRRLNMVPDFAEAVITGEDVNALTVAY
EEYLQTAKKIGKSTIEGNTVTLQIEGISAHGSTPEKGENAGLLLANFLTTVSLDGKATAF
ATFATETFTGDIFGEKATIAYKDEISGPLTVNVGRISYTKENGGNLGLNVRYPVTTNFEE
TIVKLKEYVGTHGFEVADYSNSRPHHVDKDHVLIRTLQRVYEEQTGEKAELLAIGGGTYA
RSLKAGVAFGPLFPGKEELAHQKDEYIEIEDLLKATAIYAQAIHELAK
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaattaattggacagaagaagttgcgaaacgaaaagatgatttaattcgtgat
acacaacaatttttacaaattaaaagtgtatgggaagaagaatctgcgaaagagggcgca
ccattcggtgaaggtgtagaaaaagctttatctttcatgttacataaaggagaaactgaa
ggttttacttctaaaaatttagaaggatatgcaggtcatcttgaaatggggcaaggagaa
gaattagtaggtattctctgtcacgttgacgttgtaccagaaggagatggctggacgact
cctgcatatagtgcagatattcgcgacggaaagatttttgcacgtggtgcaattgacgat
aaaggcccaacgatggcagcatattatgcgatgaaaattgtgaaagaattaggcttacct
ctttccaaacgtgttcgtatgattataggaacagatgaggaaagcaattggaaatgtgta
gatcactactttaaaaacgaagaaatgccaacaatcggttttgcgccagacgcggatttt
ccaattattaatgcagaaaaaggaatttctgatatacaagttgtgcaaaatggtagtgaa
gagaaaaaaggtacatatgaacttgtttcatttgattcagggcgccgtttaaatatggtt
cctgattttgcagaagcggttattacaggagaagatgtaaatgcacttacagtagcatat
gaagagtatttacaaactgctaaaaaaatagggaaatcgactatagaaggaaatacagtg
acgttgcaaatagaaggaatttcagcgcacggatctactcctgaaaaaggagaaaatgca
ggtttattattagcaaacttcttaactacagtttcacttgatggaaaagcaactgcattt
gcgacatttgcaacagaaacatttactggtgatatttttggtgaaaaagctactattgct
tacaaagatgaaattagcggtccgttaacagtgaatgtcggtcgcatttcttatacgaaa
gaaaacggtggtaacttagggctaaacgtacgttacccagttacaactaactttgaagaa
acaattgtgaagttgaaagaatatgttggtacgcatggttttgaagtggctgactattct
aattctcgcccacatcacgtcgataaagatcacgtattaatccgtacgttacaacgtgtg
tatgaagaacaaacaggtgaaaaagcagaactattagcaatcggcggcggtacttatgct
cgttcattaaaagctggtgtggcatttggcccgctattccctggaaaagaagaacttgcg
catcaaaaagatgagtatatcgaaattgaagacttattgaaagcaacagcaatttacgcg
caagcaattcatgaattagcgaagtaa

DBGET integrated database retrieval system