KEGG   Bacillus cereus ATCC 14579: BC4702Help
Entry
BC4702            CDS       T00127                                 

Definition
dipeptidase PepV (EC:3.4.13.3)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bce01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bce00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(4639421..4640827)
Genome map
AA seq 468 aa AA seqDB search
MSAINWTEEVAKRKDDLIRDTQQFLQIKSVWEEESAKEGAPFGEGVEKALSFMLHKGETE
GFTSKNLEGYAGHLEMGQGEELVGILCHVDVVPEGDGWTTPAYSADIRDGKIFARGAIDD
KGPTMAAYYAMKIVKELGLPLSKRVRMIIGTDEESNWKCVDHYFKNEEMPTIGFAPDADF
PIINAEKGISDIQVVQNGSEEKKGTYELVSFDSGRRLNMVPDFAEAVITGEDVNALTVAY
EEYLQTAKKIGKSTIEGNTVTLQIEGISAHGSTPEKGENAGLLLANFLTTVSLDGKATAF
ATFATETFTGDIFGEKATIAYKDEISGPLTVNVGRISYTKENGGNLGLNVRYPVTTNFEE
TIVKLKEYVGTHGFEVADYSNSRPHHVDKDHVLIRTLQRVYEEQTGEKAELLAIGGGTYA
RSLKAGVAFGPLFPGKEELAHQKDEYIEIEDLLKATAIYAQAIHELAK
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaattaattggacagaagaagttgcgaaacgaaaagatgatttaattcgtgat
acacaacaatttttacaaattaaaagtgtatgggaagaagaatctgcgaaagagggcgca
ccattcggtgaaggtgtagaaaaagctttatctttcatgttacataaaggagaaactgaa
ggttttacttctaaaaatttagaaggatatgcaggtcatcttgaaatggggcaaggagaa
gaattagtaggtattctctgtcacgttgacgttgtaccagaaggagatggctggacgact
cctgcatatagtgcagatattcgcgacggaaagatttttgcacgtggtgcaattgacgat
aaaggcccaacgatggcagcatattatgcgatgaaaattgtgaaagaattaggcttacct
ctttccaaacgtgttcgtatgattataggaacagatgaggaaagcaattggaaatgtgta
gatcactactttaaaaacgaagaaatgccaacaatcggttttgcgccagacgcggatttt
ccaattattaatgcagaaaaaggaatttctgatatacaagttgtgcaaaatggtagtgaa
gagaaaaaaggtacatatgaacttgtttcatttgattcagggcgccgtttaaatatggtt
cctgattttgcagaagcggttattacaggagaagatgtaaatgcacttacagtagcatat
gaagagtatttacaaactgctaaaaaaatagggaaatcgactatagaaggaaatacagtg
acgttgcaaatagaaggaatttcagcgcacggatctactcctgaaaaaggagaaaatgca
ggtttattattagcaaacttcttaactacagtttcacttgatggaaaagcaactgcattt
gcgacatttgcaacagaaacatttactggtgatatttttggtgaaaaagctactattgct
tacaaagatgaaattagcggtccgttaacagtgaatgtcggtcgcatttcttatacgaaa
gaaaacggtggtaacttagggctaaacgtacgttacccagttacaactaactttgaagaa
acaattgtgaagttgaaagaatatgttggtacgcatggttttgaagtggctgactattct
aattctcgcccacatcacgtcgataaagatcacgtattaatccgtacgttacaacgtgtg
tatgaagaacaaacaggtgaaaaagcagaactattagcaatcggcggcggtacttatgct
cgttcattaaaagctggtgtggcatttggcccgctattccctggaaaagaagaacttgcg
catcaaaaagatgagtatatcgaaattgaagacttattgaaagcaacagcaatttacgcg
caagcaattcatgaattagcgaagtaa

DBGET integrated database retrieval system