KEGG   Bacillus cereus ATCC 14579: BC4867Help
Entry
BC4867            CDS       T00127                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BC4867
Enzymes [BR:bce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BC4867
Exosome [BR:bce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BC4867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(4792668..4794605)
Genome map
AA seq 645 aa AA seqDB search
MNVINCEEVKRDEFHTEKYYESYNIFGAHVVTEDEIQGVRFTVWAPHAKAMSVVGDFNEW
DYEQHKMLQVTEEGIWSLFIPHIEEGEIYKYAIETLAGDVILKADPYAVYAEVRPNTASV
VFDIKGYEWNDKNWNRKKKKKSIYKEAMTVYELHFGSWKKKEDGTLYSYREMVEELIPYV
VEHQFTHIEIMPLVEHPYDRSWGYQGTGYYAATSRFGTPHDLMHFVDECHKYGIGVILDW
VPGHFCKDAHGLYLFDGTPTYEYKDKDVQENPVWGTVNFDLGKREVRNFLISNALFWMRY
FHIDGFRVDAVANMLYWNKEGQEQSNEHAVSFLRELNEAVFAEDEDFLMTAEDSTAWPLV
TTPTYEGGLGFNYKWNMGWMNDVLKYMECAPEYRKHIHEKMTFSLLYAYSENFILPLSHD
EVVHGKKSLLNKMPGDYWDKFAQLRLLYGYFFTHPGKKLLFMGGEFGQFDEWKDLEDLDW
NLHDFEMHRYMHDYFKELIALYKRSKPLWQLDHSPEGFQWIDANNNEQSIFSFIRQGDKQ
EDALVIVCNFTKATYENYKVGVPDFEYYNEILNSDAQQYGGSGQVNKKRLKTILEPYHNQ
AAHVEITIPPFGVSILRPVKTRKGSKKQDGSKTKVRSNVTSRGKR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
ttgaatgtaataaattgtgaagaagtgaaacgagatgagtttcatacagaaaagtactat
gaaagttataacatctttggcgcgcatgttgtgacggaagatgagattcaaggggtacga
tttacagtgtgggctcctcatgcgaaagcaatgagtgttgttggggattttaatgagtgg
gattatgagcaacataagatgctacaagtgacagaagaaggcatttggtccttatttata
ccgcatattgaagaaggagaaatatataaatatgcgattgaaacattggctggtgacgtc
attttaaaggcagatccgtatgctgtatatgcagaagtaagaccgaatacggcatctgta
gtttttgatataaaaggatatgaatggaatgataaaaactggaatcgtaagaaaaagaaa
aaatcgatttataaagaagcgatgacagtttatgaattacattttggttcttggaaaaag
aaagaagatggaacgctgtactcttacagggaaatggttgaagagctcatcccgtatgtg
gtggaacatcaatttacacatattgaaattatgccgcttgttgagcatccatatgatcgt
tcttggggataccaaggaacgggatattatgcagcgacgagtagatttggtacgccgcat
gatttaatgcattttgtcgacgaatgtcataaatatggaatcggtgtcattttagattgg
gtgccggggcatttttgtaaagatgctcacggtttatatttgtttgatggtacaccgacc
tatgaatataaagataaagatgtacaagaaaatccagtatggggaactgtcaattttgat
ttaggaaagagagaggtacgtaatttcttaatttcaaatgcgttattttggatgagatat
ttccatattgatggtttcagagttgatgcagttgcgaacatgttgtactggaataaagaa
ggacaagagcaaagtaatgagcatgctgtttcatttttaagagagttaaatgaagcagtg
tttgcagaggatgaagattttcttatgacggcagaagattcaacagcttggccacttgta
acaactccaacgtatgaaggtgggcttggattcaattacaaatggaacatgggctggatg
aatgacgtgctgaaatatatggagtgtgcgcctgaatataggaaacacattcatgagaaa
atgacgttttctttgctatatgcgtactctgaaaacttcatattaccgctttctcatgat
gaagtcgttcatgggaaaaagtcgttattaaataaaatgccaggtgattactgggataag
tttgctcagcttcgtttattatatggatatttctttactcacccaggaaagaaattactt
ttcatgggaggggaattcggacagtttgatgagtggaaagaccttgaagatttagattgg
aatttacatgattttgaaatgcatcgttatatgcatgattactttaaagagctcatagca
ttgtataagcgctcaaaaccactttggcagcttgatcattcgcctgaaggttttcagtgg
attgatgctaataataacgagcaaagtattttctcgtttatccgccaaggggataaacaa
gaggatgcgttagttatcgtatgtaattttacgaaagctacatatgaaaactataaagta
ggtgtaccagatttcgagtattataacgagattttaaacagtgatgcacagcaatatggc
ggttcggggcaagtgaataagaaacgtcttaagacgattctagaaccgtaccataatcaa
gcagcacatgtagagattacaattccaccatttggcgtatccatattacgaccagtgaag
acgagaaaggggagcaaaaaacaagatggctcaaaaacaaaagtgcgtagcaatgttact
agcagggggaaaaggtag

DBGET integrated database retrieval system