KEGG   Bacillus cereus ATCC 14579: BC4918Help
Entry
BC4918            CDS       T00127                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BC4918
   00052 Galactose metabolism
    BC4918
   00500 Starch and sucrose metabolism
    BC4918
   00520 Amino sugar and nucleotide sugar metabolism
    BC4918
Enzymes [BR:bce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BC4918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4828146..4829036)
Genome map
AA seq 296 aa AA seqDB search
MMKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGK
TKRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARK
FIGDEPFAVLLGDDIVQAEKPCLRQLMDEYEKTLSSVIGVQTVPESETHRYGIIDPLEQE
GRRYQVRNFVEKPAQGTAPSNLAIMGRYILTPEIFMFLEQQHVGAGGEIQLTDAIQSLNE
IQRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVAMMKKILEEQANQES
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaaaaagtaagaaaagcgataatcccagcagctggattaggaacacgtttttta
ccagctacgaaagcaatgccgaaagaaatgttaccgatagtagataaaccaacgatccaa
tacattgtagaagaagcagtgaaatcgggtatcgaagatattattatcgttactggtaaa
acaaagcgctctatcgaagatcattttgataacgcatttgaactagaacaaaacttatta
gagaagaaaaaatatgagttgcttgaaaaagtacaagcttcttcaaaaatggtagatatt
cattacatccgtcaaaaagagccgaagggactaggacatgctgtttggtgtgcgcgtaaa
ttcattggtgatgagccgtttgcagtgttactaggtgatgatattgtccaagctgagaaa
ccgtgtttacgtcaattaatggatgagtatgaaaaaacactttcttctgttattggtgta
caaactgttccagagtcggaaacacatcgctatggaattatcgatccattagaacaagaa
ggtcgtcgttaccaagttcgcaatttcgttgagaaaccagcacaaggtacagctccttca
aacttagcaattatgggccgttacattttaacgcctgaaatctttatgttcttagaacag
caacatgtcggtgctggtggtgaaattcaattaacagatgcaatccaaagcttaaatgaa
atccaacgtgtatttgcttacgatttcgaaggaaagcgctacgacgtaggtgaaaagcta
ggattcgttcaaacgacaattgaaatggccctgcaacacccagaattgcgtgatgacatg
gttgcaatgatgaagaaaattttagaagaacaagcgaatcaagagtcttaa

DBGET integrated database retrieval system