KEGG   Bacillus cereus ATCC 14579: BC4971Help
Entry
BC4971            CDS       T00127                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BC4971
   01230 Biosynthesis of amino acids
    BC4971
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC4971
  Energy metabolism
   00680 Methane metabolism
    BC4971
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BC4971
Enzymes [BR:bce01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BC4971
Exosome [BR:bce04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BC4971
  Exosomal proteins of melanoma cells
   BC4971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4878930..4879484
Genome map
AA seq 184 aa AA seqDB search
MKKIIIIRHCSAIGQKRDDELTTDGKDQANTLATFLLENHLQIDHIISSPFVRAIDSIRP
YALQANLSIQEDERLTERILSNIPMDDWMQKLESTFTNIDIAFSGGESTKQATDRALSLI
QDVLQLNHTTTLLVTHGNLLTLILKHFDHTIGFNEWRTLTNPDIYEITIDEQCIIKRLWE
ASSK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattattataatacgacattgttcagcaattgggcaaaaacgtgatgatgaa
ttaacgaccgatggaaaagaccaagcaaacacccttgctacattcctcttagaaaatcat
ctacaaatcgatcatattatttcaagcccatttgtccgagctatcgattccattcggccc
tatgcgctccaagctaacttatctatccaagaagatgaacgattaactgaacgcatattg
agcaacattccaatggatgattggatgcaaaaactagaatctacttttacaaatatagat
attgccttttcaggcggagagtcaacaaaacaagcaacagaccgggccctatcgcttatt
caagacgttttacaattaaaccatacgacaacactacttgttacacatggcaatttactt
acgctcattttaaagcattttgatcatacaattggctttaatgaatggagaactttaacg
aatcctgatatttacgaaattacaatcgacgaacaatgtatcataaaacgcttatgggaa
gcatcgtccaagtaa

DBGET integrated database retrieval system