KEGG   Bacillus cereus ATCC 14579: BC4971Help
Entry
BC4971            CDS       T00127                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00010  Glycolysis / Gluconeogenesis
bce00260  Glycine, serine and threonine metabolism
bce00680  Methane metabolism
bce01100  Metabolic pathways
bce01110  Biosynthesis of secondary metabolites
bce01120  Microbial metabolism in diverse environments
bce01130  Biosynthesis of antibiotics
bce01200  Carbon metabolism
bce01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BC4971
  Energy metabolism
   00680 Methane metabolism
    BC4971
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BC4971
Enzymes [BR:bce01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BC4971
Membrane trafficking [BR:bce04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BC4971
Exosome [BR:bce04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BC4971
  Exosomal proteins of melanoma cells
   BC4971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 1207313
NCBI-ProteinID: NP_834642
UniProt: Q816A2
Position
4878930..4879484
Genome map
AA seq 184 aa AA seqDB search
MKKIIIIRHCSAIGQKRDDELTTDGKDQANTLATFLLENHLQIDHIISSPFVRAIDSIRP
YALQANLSIQEDERLTERILSNIPMDDWMQKLESTFTNIDIAFSGGESTKQATDRALSLI
QDVLQLNHTTTLLVTHGNLLTLILKHFDHTIGFNEWRTLTNPDIYEITIDEQCIIKRLWE
ASSK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattattataatacgacattgttcagcaattgggcaaaaacgtgatgatgaa
ttaacgaccgatggaaaagaccaagcaaacacccttgctacattcctcttagaaaatcat
ctacaaatcgatcatattatttcaagcccatttgtccgagctatcgattccattcggccc
tatgcgctccaagctaacttatctatccaagaagatgaacgattaactgaacgcatattg
agcaacattccaatggatgattggatgcaaaaactagaatctacttttacaaatatagat
attgccttttcaggcggagagtcaacaaaacaagcaacagaccgggccctatcgcttatt
caagacgttttacaattaaaccatacgacaacactacttgttacacatggcaatttactt
acgctcattttaaagcattttgatcatacaattggctttaatgaatggagaactttaacg
aatcctgatatttacgaaattacaatcgacgaacaatgtatcataaaacgcttatgggaa
gcatcgtccaagtaa

DBGET integrated database retrieval system