KEGG   Bacillus cereus ATCC 14579: BC5073Help
Entry
BC5073            CDS       T00127                                 

Definition
(RefSeq) spermidine N1-acetyltransferase
  KO
K00657  
diamine N-acetyltransferase [EC:2.3.1.57]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BC5073
Enzymes [BR:bce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.57  diamine N-acetyltransferase
     BC5073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(4980481..4980996)
Genome map
AA seq 171 aa AA seqDB search
MNQELKLRPLEREDLKFVHELNNNAHIMSYWFEEPYEAFVELQDLYDKHIHDQSERRFIV
EKDNEMVGLVELVEIDYIHRRTEFQIIIDPNYQGYGYAVEATRLAMDYAFAVLNMHKIYL
VVDKENEKAVHVYKKVGFMVEGELIDEFFVDGNYHNAIRMCMFQKQYFENK
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggaattgaagttacgtccattggaacgagaagatttaaagttcgtacacgaa
ctgaataataatgcgcatattatgtcgtattggtttgaagagccatatgaggcatttgtg
gagctgcaagacttatacgataaacatatacatgatcaaagcgaacgccgatttatcgtt
gagaaagacaatgaaatggttggattagttgagttagtagaaatcgattatattcatcgt
agaacagaattccaaattattattgatccgaattatcaaggatatggttatgcagtagag
gcgacgcgtttagcaatggattatgctttcgctgtattaaatatgcataagatatattta
gttgtggataaggaaaatgaaaaagcagtacatgtttataaaaaagttgggtttatggta
gaaggtgagcttatcgatgagtttttcgttgatggtaactatcataatgcgataagaatg
tgtatgtttcagaagcaatattttgaaaacaagtag

DBGET integrated database retrieval system