KEGG   Bacillus cereus ATCC 14579: BC5074Help
Entry
BC5074            CDS       T00127                                 

Definition
(RefSeq) MerR family transcriptional regulator
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(4981513..4981884)
Genome map
AA seq 123 aa AA seqDB search
MYTISQLIEQTGITSRTIRYYEELGLLILEKQNGKRILNDENLLQLIKIFLMKITNKKLK
DIKDIDLEKLQLTLLNQEINLLCQQLIGLSLTLEGLLEETNVEREFQLLKELNNYININV
NLN
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgtatacaatttctcaattaattgaacaaacaggtattactagtagaactatacgttac
tatgaagaattagggttattaattttagaaaagcagaatggaaaacgaattttaaatgat
gaaaacctattacaacttattaagattttcttaatgaaaattactaataaaaagttgaaa
gatattaaagacattgatcttgaaaagctacaattaactttattaaatcaagagataaac
ttattatgtcaacaattgatagggttgtctttaacgttagaggggttattggaagaaaca
aatgtggaaagggaatttcaattgttaaaggaacttaataattatattaatataaatgta
aacttaaactag

DBGET integrated database retrieval system