KEGG   Bacillus cereus ATCC 14579: BC5076Help
Entry
BC5076            CDS       T00127                                 

Definition
(RefSeq) short chain dehydrogenase
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(4983112..4983894)
Genome map
AA seq 260 aa AA seqDB search
MILSKNTFVILKIFDINSNCGGILMKKVVVITGASDGIGYETAIYLASKGMIVVLSSRNK
TKLESVRKKIHTMGGEAIVIPADISKAKEVEQLINKTIELYGRIDVLINNAGVMPLSWLK
NFDIREASSAIDVNIKGVLYGIRYVLPHMLTRDEGIIVNIGSTVSYEIPPYGVIYSATKH
AVNAITKGLHKELSMSKSKVRLILISPGPVETNLMKNTNAGLKSQTYKTSTFSPVYVAES
IYRSLEDRTEPKFSEIITYP
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
ttgatcttatcgaagaatacatttgttattttaaaaatctttgatataaattctaattgt
ggtgggatacttatgaaaaaggttgttgttattactggtgccagtgatggtataggatat
gagactgcaatttatttagcgagtaagggtatgatagtagtattgtcgtcccgaaataag
actaaactggagagtgtaagaaaaaaaatacatactatgggcggagaggctattgttatc
cctgcggatatttctaaagcaaaagaggtcgagcaactaattaacaaaaccatagagtta
tatggaagaattgatgttttgattaataatgccggagtaatgcctttatcgtggttgaaa
aattttgatatacgagaggctagtagtgcaattgatgttaatattaaaggagtactatat
ggaatacgctatgtattgccgcatatgttaactagagatgaagggattattgttaatatt
ggatcaacagttagttatgaaatacctccatatggggtaatatatagtgctaccaaacat
gcggtaaatgctataactaaaggattacataaagagttgtcaatgagtaaatcaaaagtt
agattgattttaatatctccaggccctgttgaaacaaaccttatgaaaaatacaaatgct
ggtcttaaatctcaaacatataagacatctacattttcaccagtatatgttgctgagtcc
atctacagatccctagaagatcgtacagagcctaaattttctgaaattataacgtatcca
taa

DBGET integrated database retrieval system