KEGG   Bacillus cereus ATCC 14579: BC5077Help
Entry
BC5077            CDS       T00127                                 

Definition
(RefSeq) hypothetical protein
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(4983851..4984330)
Genome map
AA seq 159 aa AA seqDB search
MRIDGTSQNIKDEFQRIIQESTPLMLSNNYVTDFEVLHCEPVKYDDYHILISIFFAGKPV
YMFGIINLSKNQGSLKIYNYYSFENFLFDMTDMVIKNFRNVSFKYQRKLIFNMGKELYDY
LVDFNGKIRPISEEMSEDIYNNLIDIDLIEEYICYFKNL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgagaatagatggtacatcccagaatataaaagatgaattccaacgtataattcaagaa
tctacacctcttatgttatctaataattatgttactgattttgaagtattacattgtgaa
cctgtaaaatatgatgattatcatattttaattagtatattttttgcaggaaaaccagta
tatatgtttgggattataaatttatctaaaaaccagggttctttaaaaatatacaattat
tattcatttgaaaattttttattcgatatgacggatatggttataaaaaatttcagaaat
gtttcatttaaatatcaacgaaagttaatttttaatatgggaaaagagttatatgactat
ttagtagattttaatggtaagattcgacccataagtgaagaaatgagtgaggatatatac
aataatcttattgatattgatcttatcgaagaatacatttgttattttaaaaatctttga

DBGET integrated database retrieval system