KEGG   Bacillus cereus ATCC 14579: BC5083Help
Entry
BC5083            CDS       T00127                                 

Definition
(RefSeq) lantibiotic biosynthesis protein
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(4989031..4990002)
Genome map
AA seq 323 aa AA seqDB search
MNENNFIWKAYHIFYHQNQDFLITNCIKPILDELIKKKLISKFFFIRYWEGGPHIRVRLY
CTLNKSQEVDYKFNDFVSKFLKTYPSSSTLDRNMIKNQLAKLASLEEGTESTCVRENNHI
IHLEYNPEYKRYGGENGIEIAEEHFYHSSIMCLKLIQEINKKTNRLRISIEIILSYLKAM
NMNLQESIKFLEGYYLIWKRYVYSNTNNVEEFFANKYIKQKKVIDKIVVNYFNSNNNKGM
LGEKWSNHLNLTVQNLENDWDRGELIIDKDVLAYINIPQKIAFIVTSYVHMTNNRLGIMP
QEEAYLSYMLLCSLKSLYKSRKG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaataattttatatggaaggcttatcatattttttatcatcaaaatcaagat
tttctaattacaaattgtatcaaaccaattttagatgaattgataaaaaagaaattaatt
agtaaatttttttttataagatattgggaaggcggacctcatattagagtgcgactttat
tgtacattaaataaatctcaagaagttgattataaatttaatgattttgtttctaaattc
ttgaaaacatatccttcttcatcaacattagatagaaacatgataaagaatcaattagca
aaattagctagtcttgaagagggtactgagtcaacatgtgttcgagagaataatcatatt
attcatctagaatataatccagagtataaacgatatggaggagaaaatggaatagagatt
gcggaagaacatttttaccattcaagtataatgtgtttgaagttaatacaagaaattaat
aaaaagacaaatcgtttgcgcatatctattgaaattatactatcttatttaaaagctatg
aatatgaacttacaagagagtattaagtttttagaaggctattatctaatatggaaaaga
tatgtatacagcaataccaataacgttgaagaattcttcgctaacaaatatattaagcaa
aaaaaagtaatagacaaaattgtagtaaactatttcaattctaataataataaaggtatg
ttaggagaaaaatggagtaatcatttgaatttaactgtacagaatttagaaaatgattgg
gatcggggagaattaataatagataaagatgttttagcatatataaatatccctcaaaag
attgcttttatagttacaagttatgttcatatgacaaacaataggcttggtatcatgccg
caagaagaagcctatttaagctatatgcttttatgtagtttgaaatcattgtataagagt
agaaagggatga

DBGET integrated database retrieval system