KEGG   Bacillus cereus ATCC 14579: BC5085Help
Entry
BC5085            CDS       T00127                                 

Definition
(RefSeq) hypothetical protein
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(4992661..4994304)
Genome map
AA seq 547 aa AA seqDB search
MTKKDRINLFELKKCLSEGHNVKISGDLLNASMVGLAITLAFKLINNEVSEFSYIIDKKT
LRFNGHNFLPNPHCQVCGHMDNDEKRLIEHKFFTALNDNTLKEKKGNRFLSKEYLEDTLS
KNFLDVETGIFNKLLDDYESPFAVSVANLPLKVGKDEVGVGRTDNYANSHLTAILEGIER
YCGMEPRGNRTNVFGSYNELMENALNPSVLGLHAEEQYQLKRFPFNKYNPDKKMKWVWGY
SFNKNKAILVPETYAYYGTNYRDGVQNSFVYEISNGCALGGHLLEATLQGIYEVVERDAF
LISWYTKLPLKRIRKESIKDQTIQLLLTRFEYQTDYDIHLYNMTLENKIPTILAIAKNRG
AFGMNILCAAGCHLDINKAIESSLHELCGILEAIKSKFENRKSELYEMAKNYSLVRTMED
HSLLFGLKELEKEFDFLLKSPIEIDLSEVEPLKYSNNIHTDLLNVIDYFKKINLDIIVVD
QTAEDIKFNNLYCVKVIIPGMLPMTFGHDMRRIHNLPRIFRVPRELGHKIKNENEIKNNQ
VTPHPFP
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaaggatcgtattaatttatttgaattgaagaaatgtttatcagaaggacat
aatgtaaaaatatctggagatttattgaatgcttcaatggttggattagcaattacttta
gcatttaaactaataaataatgaggtttcggaattttcgtatattattgacaaaaagaca
ttgagattcaatggtcataattttttacctaatccacattgtcaagtatgtgggcacatg
gataatgacgagaaaagattaatagaacacaaattttttacagcacttaacgataatact
cttaaagaaaagaaaggaaatcgttttttatcaaaagaatatttagaagataccctatct
aaaaattttttagatgtagaaactggtatatttaataaacttttggacgattatgaaagt
cctttcgcagtttcggtagcaaatcttcctttaaaggttggaaaggatgaggttggtgtt
ggaagaacggataattatgctaatagtcacttaactgcaatattagaaggaatagagaga
tattgcggaatggaaccaagggggaatagaactaacgtttttggtagttataatgagcta
atggaaaatgctctcaatccatctgttttaggattacacgcggaagaacagtatcaatta
aaaagatttccttttaataaatataatccagataaaaaaatgaaatgggtctgggggtat
tcttttaataagaataaggcgatattagtccctgaaacttatgcctattatggtacgaat
tatagagatggcgttcaaaatagttttgtttatgaaatctcgaatggatgtgctttagga
ggacatttattggaagctacattgcaaggaatttatgaagtagtggaaagagatgctttt
cttatatcttggtatactaaattaccattaaaacgtataagaaaagaatctattaaggat
cagacgattcaattattattaacgagatttgaatatcaaactgattatgatattcatctg
tataatatgactttagagaataaaataccaactattttagctattgcaaaaaatagaggt
gcttttggcatgaatattttatgtgctgcaggttgtcatttagatataaataaagcaatt
gaaagttcattacatgagttatgtggaatcttagaggcaatcaaaagtaaatttgaaaat
aggaaaagtgaattatacgaaatggcaaagaattattcacttgtacggacgatggaagat
cattcattattatttggattgaaagaacttgaaaaagagtttgattttctattaaagagc
ccgattgaaattgatttaagtgaggtagaacctttaaaatatagcaacaatatacataca
gatttattgaatgtaattgattattttaaaaaaataaatttagatatcatcgtagtcgat
caaaccgcggaagatataaaatttaacaacttgtattgtgtaaaagttattattccagga
atgttacctatgacatttggacatgatatgagaagaatacataatttaccaaggatattc
cgtgttccaagggaattaggacataaaattaagaatgaaaatgaaattaagaacaatcag
gtaactcctcatcctttcccataa

DBGET integrated database retrieval system