KEGG   Bacillus cereus ATCC 14579: BC5086Help
Entry
BC5086            CDS       T00127                                 

Definition
(RefSeq) lantibiotic biosynthesis protein
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(4994656..4996167)
Genome map
AA seq 503 aa AA seqDB search
MVNIPLKDIVSELSKTQEEKFLKLIAILEKNGFVKYTERVIDENYYKNYEKEIAFIDYYT
NNGIELFKKLSNFKICLYGSNKLSNTIQKSLENIGIQNIKRGSRFDFEGDIVIYCNNDVN
ERENLLECMDFSQNKIFIFVGNKESLGIISPIIKNLDDWKEFENILEIGADNIKENTTFT
SNSILSSMLSFEIIKYVTNCLQSDLINAAYILNTDTLKGNFVQVKKKIDLKQDFIETFKQ
SSGGNGLYINKIGRGSRKQIPLSQWEVELDKLGDMNSEKIKVVSFGDTHQEARFNTYYKT
IEHLIINGEFNLEESYSFKNLDTITLAIDEQFKRKLTISCDIDKELAIRKAILKAILKRE
INVIDNYQELSPLKISDYIDNKNIQYYCKLINILKAKIELRFKKLVEGLFLVVVSDNSYR
GVSIGFNLNTALENALRQFINNLQNSIYTINIEDVIFKRINDWDDECIREFLTDEKLEVF
ICSIQNNVISAEISIVGAILIES
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggtaaatatacctttgaaagatatagtgagtgagttaagcaaaacccaagaagaaaaa
tttttaaaattaattgccatattagagaagaatggttttgtaaaatataccgaaagggtt
attgatgaaaattattataaaaattatgaaaaagaaattgcatttatagattattatact
aataatggcatcgaattatttaaaaaactctctaatttcaagatttgtttatatggtagc
aataagttatctaatactattcaaaaaagcttagaaaacatagggatacaaaatattaaa
agaggctctcgttttgattttgagggagacattgttatttattgcaataatgatgttaat
gaaagggaaaatctactggaatgtatggacttttctcagaataaaatatttatttttgta
ggtaataaagaatcattaggaattattagtcctattataaaaaatttagatgattggaag
gaatttgaaaatatattagagattggtgcagataatattaaagaaaatacaacatttact
agcaactctatattaagtagtatgctaagttttgaaattataaagtatgtaacaaattgt
ttgcaaagtgatttaattaatgcggcatacattttaaatactgatactttaaaagggaat
tttgttcaggtaaaaaaaaaaatagacttaaaacaagattttattgaaactttcaaacaa
tcaagcggaggcaacggtttgtatatcaataaaataggtagaggttctaggaaacaaatt
ccgctctcgcaatgggaggttgaattggataaattaggtgacatgaatagtgaaaaaatt
aaggtcgttagctttggtgatacccaccaggaagcgaggtttaatacttattataaaacc
atagaacatctaataatcaatggggaatttaacttagaggaatcatatagctttaagaat
cttgatacaatcactttagctattgatgaacaatttaaaagaaaattaacaatttcatgc
gacatagataaagaacttgcaatcagaaaagcaatattaaaagcaattttaaagagggaa
attaatgtaattgataattatcaagagctttccccattaaaaataagtgattatatagat
aataaaaatatacaatactattgtaaactgattaacattttaaaagcgaaaatagaattg
cgttttaagaaattagtagagggtttgtttttggtagtagttagtgacaatagttatagg
ggagttagtataggatttaatttaaatacagcattagaaaatgctcttaggcaatttatt
aataatttacaaaatagtatctatacaataaatattgaagatgtaatatttaaaagaatt
aatgattgggatgatgaatgcattcgagagtttttgacagatgaaaaattagaagttttt
atctgtagtatacaaaataatgttatttcagcagaaatttctatagttggagcaatatta
atagaaagttag

DBGET integrated database retrieval system