KEGG   Bacillus cereus ATCC 14579: BC5093Help
Entry
BC5093            CDS       T00127                                 

Definition
(RefSeq) xanthine permease
Organism
bce  Bacillus cereus ATCC 14579
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
4998622..4998933
Genome map
AA seq 103 aa AA seqDB search
MLPLIYQSDMPSQTPLVKLSQMFAWGTPRFNIGITLTTTLFTLLLVVNTITAKRSVNKVY
PLSKENEKQTLNCDIWDRGISYIISSLFSTIETVPLSTSTGFI
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
ttgcttcctttaatttatcaaagcgatatgccttcacaaacaccgttagttaagttatca
cagatgtttgcttggggcacacctagattcaatattggaataactctaactacaacttta
tttacacttcttttagttgtaaatacgattactgctaaaagaagtgtaaataaagtttat
ccgttatctaaagaaaatgaaaaacaaacactgaactgtgacatatgggacagaggtata
tcatatattatctcatcgctgttttctacaattgaaactgtaccgctatctacatcaaca
ggatttatttaa

DBGET integrated database retrieval system