KEGG   Bacillus cereus ATCC 14579: BC5275Help
Entry
BC5275            CDS       T00127                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
bce00040  Pentose and glucuronate interconversions
bce00052  Galactose metabolism
bce00500  Starch and sucrose metabolism
bce00520  Amino sugar and nucleotide sugar metabolism
bce01100  Metabolic pathways
bce01130  Biosynthesis of antibiotics
Module
bce_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BC5275
   00052 Galactose metabolism
    BC5275
   00500 Starch and sucrose metabolism
    BC5275
   00520 Amino sugar and nucleotide sugar metabolism
    BC5275
Enzymes [BR:bce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BC5275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 CTP_transf_3 IspD Smr PHZA_PHZB
Motif
Other DBs
NCBI-GeneID: 1207615
NCBI-ProteinID: NP_834938
UniProt: Q814Z2
Position
complement(5185367..5186248)
Genome map
AA seq 293 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPVTKAMPKEMLPIVDKPTIQYIVEEAIESGIEDIIIVTGKG
KRAIEDHFDHSFELEQSLLEKGKHEMLEKVQASSKINIHYIRQKEPKGLGHAVWCARKFI
GNEPFAVLLGDDIVQAETPCLRQLMDQYEGTQSSVIGVQTVPENETHRYGIIDPVEQNDR
RYQVRQFVEKPEQGTAPSNLAIMGRYVLTPEIFMFLENQQTGAGGEIQLTDAIQRLNEVQ
RVFAYDFKGTRYDVGEKFGFIKTTIEMALQNEELNVELMKYMKELVKKEEVHS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaagtaagaaaagcaattattccagctgcgggactggggacaaggtttttaccg
gtaacaaaggcaatgccgaaagaaatgttaccaattgttgataaaccaacaattcaatac
atagtagaagaagcgatagaatcaggaattgaagatattattattgttactggaaaagga
aaacgcgccattgaagatcactttgatcattcttttgaattggagcaaagcctactagaa
aaagggaagcatgaaatgctagaaaaagtacaagcttcttcaaaaattaatattcattac
ataagacaaaaggaaccaaaaggtttaggacacgcagtatggtgtgcacgtaaatttatt
ggaaatgaaccatttgcggtattacttggtgatgatattgtgcaagcagaaacgccatgt
ttgcgtcaattaatggatcaatatgaaggaacacaatcatctgttataggtgtacaaaca
gtaccagaaaatgaaacgcatcgttacggtattatcgatccagttgaacaaaatgatcga
cgttatcaagtacgtcaatttgtagagaagccagagcaaggaacagcaccatcaaattta
gcaattatgggacgttacgtattaacaccagaaatctttatgttccttgaaaatcaacaa
acaggtgcgggtggagaaatccaattaacagatgcaattcaacgattaaatgaagttcaa
cgtgtatttgcttatgattttaaaggtacgcgttacgatgttggggagaagtttggattt
attaagacgacgattgagatggcgctacaaaatgaagaattaaatgtagagttaatgaag
tatatgaaggagcttgtaaaaaaggaagaggtacattcatag

DBGET integrated database retrieval system