KEGG   Bacillus cereus ATCC 14579: BC5370Help
Entry
BC5370            CDS       T00127                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bce  Bacillus cereus ATCC 14579
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:bce00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BC5370
Enzymes [BR:bce01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BC5370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5287228..5288100)
Genome map
AA seq 290 aa AA seqDB search
MRFDEAYSGKVFIKSHPSFEESKVVIYGMPMDWTVSYRPGSRFGPARIREVSIGLEEYSP
YLDRELEEVKYFDAGDIPLPFGNAQRSLDMIEEYVSKLLDADKFPLGLGGEHLVSWPIFK
AMAKKYPDLAIIHMDAHTDLRESYEGEPLSHSTPIRKVCDLIGPENVYSFGIRSGMKEEF
EWAKEVGMNLYKFDVLEPLKEVLPKLAGRPVYVTIDIDVLDPAHAPGTGTLEAGGITSKE
LLDSIVAIANSNINVVGADLVEVAPVYDHSDQTPVAASKFVREMLLGWVK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttgatgaagcttattcaggtaaagtatttattaaaagtcatccaagttttgaa
gagtcaaaggtagttatttatgggatgcctatggattggacagtaagttaccgtccggga
tctcgttttggccctgcacgtattcgtgaagtatcaatcggtcttgaagaatatagcccg
tatttagatcgtgaactagaagaggtaaaatattttgatgcgggtgatatcccattacca
ttcggaaacgcacaacgcagcttagacatgattgaagagtatgtatcaaaacttttagat
gccgataagtttccactaggtctcggcggtgagcacctagtgtcttggccaatttttaag
gcaatggcaaaaaaatatccggatttagcaatcatccacatggatgctcatactgattta
cgtgaatcgtatgaaggggagcctttatcccactctacaccaattcgtaaagtgtgtgat
ttaattggtccggaaaacgtatattctttcggaattcgttctggaatgaaggaagaattt
gaatgggcgaaagaagtaggtatgaacttatacaaatttgacgtattagaaccgttaaaa
gaagtattaccgaaacttgctggccgcccagtctatgtcacaatcgacattgatgtatta
gacccagctcacgctccaggaacaggaacgttagaagctggcggtatcacatctaaagaa
ttattagattccatcgtagcaattgcaaattcaaatataaatgtagttggagcagacttg
gtagaagtagctccagtctacgaccatagtgatcaaacaccagtcgcagcaagcaaattc
gtgcgggaaatgctgctcggttgggtaaaataa

DBGET integrated database retrieval system