KEGG   Burkholderia cepacia DDS 7H-2: DM42_3196Help
Entry
DM42_3196         CDS       T03302                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
bced00071  Fatty acid degradation
bced00072  Synthesis and degradation of ketone bodies
bced00280  Valine, leucine and isoleucine degradation
bced00310  Lysine degradation
bced00362  Benzoate degradation
bced00380  Tryptophan metabolism
bced00620  Pyruvate metabolism
bced00630  Glyoxylate and dicarboxylate metabolism
bced00640  Propanoate metabolism
bced00650  Butanoate metabolism
bced00900  Terpenoid backbone biosynthesis
bced01100  Metabolic pathways
bced01110  Biosynthesis of secondary metabolites
bced01120  Microbial metabolism in diverse environments
bced01130  Biosynthesis of antibiotics
bced01200  Carbon metabolism
bced01212  Fatty acid metabolism
bced02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bced00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DM42_3196
   00630 Glyoxylate and dicarboxylate metabolism
    DM42_3196
   00640 Propanoate metabolism
    DM42_3196
   00650 Butanoate metabolism
    DM42_3196
  Lipid metabolism
   00071 Fatty acid degradation
    DM42_3196
   00072 Synthesis and degradation of ketone bodies
    DM42_3196
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DM42_3196
   00310 Lysine degradation
    DM42_3196
   00380 Tryptophan metabolism
    DM42_3196
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DM42_3196
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DM42_3196
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DM42_3196
Enzymes [BR:bced01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DM42_3196
Exosome [BR:bced04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DM42_3196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIO48723
UniProt: A0A095DUA2
Position
1:3451416..3452594
Genome map
AA seq 392 aa AA seqDB search
MTEAVIVSTARTPLAKSWRGAFNMTHGATLGGHVVAAALERAKLDPARVEDVIMGCANPE
GATGANIARQIALRAGLPVSVPGMTVNRFCSSGLQTIALAAQRIIAGEGEIYVAGGVESI
SCVQNEMNRHMIQEGWLVQHKPEIYWNMLQTAENVAKRYGISKERQDAYGVQSQLRAAAA
QEAGLFLDEIVPITVLAGIADKATGRLFTQEVTVSADEGIRPDTTLEGVSKIRSAVPGGV
ITAGNASQFSDGASACVVMSAEAAQREGLQPLGAFRGFAVAGCEPDEMGIGPVFAVPKLL
KQAGLKVDDIGLWELNEAFAVQVLYCRDTLGIPEDRLNVNGGAIAVGHPYGVSGARLTGH
ALIEGKRRGVKYVVVTMCIGGGQGAAGLFEIL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagccgtaatcgtatcgaccgcacgcacgccgctggcgaaatcctggcgcggt
gcattcaacatgacgcacggcgcgacgctcggcggccacgtggtcgcggccgcgctcgag
cgcgcgaagctcgaccccgcccgcgtcgaggacgtgatcatgggctgcgcgaaccccgaa
ggcgcgacgggcgcgaacatcgcgcggcagatcgcgttgcgcgccggcttgccggtgagc
gtgccggggatgacggtgaaccgcttctgttcgtcagggctgcagaccatcgcgctggcc
gcgcagcggatcatcgcgggcgaaggcgagatctatgtggccggtggcgtcgagtcgatc
tcgtgcgtgcagaacgagatgaaccggcacatgatccaggaaggctggctcgtccagcac
aagcccgagatctactggaacatgctgcagaccgccgagaacgtcgcgaagcgctacggc
atctcgaaggagcggcaggacgcgtacggcgtgcagtcgcaactgcgcgcggcggccgcg
caggaagccgggctgttcctcgacgagatcgtaccgatcaccgtgctggcgggcatcgcc
gacaaggcgacgggccgcctgttcacgcaggaagtgacggtgtcggccgacgaaggcatc
cggcccgacacgacgctcgaaggcgtgtcgaagatccgttcggcggtgccgggcggcgtg
atcaccgcgggcaacgcgagccagttctcggacggcgcgtcggcgtgcgtcgtgatgagc
gccgaggccgcgcagcgcgaagggctgcagccgctgggtgcgttccgcggcttcgcggtg
gccggctgcgagccggacgaaatgggcatcggcccggtgttcgcggtgcccaagctcctg
aagcaggcggggctgaaggtcgacgacatcggcctgtgggagctgaacgaggcgttcgcg
gtgcaggtgctgtattgccgcgacacgctcgggatccctgaggatcgcctgaacgtgaac
ggcggcgcgatcgcggtcggccacccgtacggcgtgtcgggcgcacgcctgacgggccat
gcgctgatcgaaggcaagcggcgcggcgtcaagtacgtggtcgtcacgatgtgcatcggc
ggcgggcagggcgcggccggcctgttcgaaatcctctga

DBGET integrated database retrieval system