KEGG   Burkholderia cepacia DDS 7H-2: DM42_6329Help
Entry
DM42_6329         CDS       T03302                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bced  Burkholderia cepacia DDS 7H-2
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:bced00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DM42_6329
   00630 Glyoxylate and dicarboxylate metabolism
    DM42_6329
   00640 Propanoate metabolism
    DM42_6329
   00650 Butanoate metabolism
    DM42_6329
  Lipid metabolism
   00071 Fatty acid degradation
    DM42_6329
   00072 Synthesis and degradation of ketone bodies
    DM42_6329
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DM42_6329
   00310 Lysine degradation
    DM42_6329
   00380 Tryptophan metabolism
    DM42_6329
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DM42_6329
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DM42_6329
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DM42_6329
Enzymes [BR:bced01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DM42_6329
Exosome [BR:bced04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DM42_6329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:3144359..3145510
Genome map
AA seq 383 aa AA seqDB search
MKQAYIVDALRTPTGRRKGGLAHVHAADLGGFVLKTLVERNAIPADEYDDVVFGCVDTIG
PLAGNIARTCWLAAGLPLQVPGVTVDRQCGSSQQAVHFAAQAVMSGVQDVVVAGGVQTMT
QIPISSAMTCAAPLGFTDPFSGSAGWRARFGDAPVSQFVAAQRIADHWNLSRDAMERYAL
ESHRRAVAAIEGGHFKREIVPFEGVMHDETPRPDTSLDKMATLEPLTPGGSLTAAVASQT
CDAAAALLIVSEEALKRYDLTPRARIHHLSVLGDDPLWMLTAPIPATRAALKKSGLDLAR
IDVVELNEAFASVAQAWLADTRFPHEKTNPNGGAIALGHPLGATGARLMTTLLHELERTG
GRYGLQTMCEGGGLANVTIIERL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagcctatatcgtcgacgcgctgcgcacgcccaccggccgccgcaagggcggg
ctcgcgcacgtgcatgcggcggacctcggcggcttcgtgctgaagacgctcgtcgagcgc
aacgcgatcccggccgacgaatacgacgacgtggtgttcggctgcgtcgatacgatcggc
ccgctcgcgggcaacatcgcgcgcacctgctggctcgcggccgggctgccgctgcaggtg
ccgggcgtgacggtcgaccgccagtgcggctcgtcgcagcaggccgtgcacttcgccgcg
caggccgtgatgagcggcgtgcaggacgtggtcgtcgccggcggcgtgcagacgatgacg
cagatcccgatctcgtctgcgatgacctgcgcggcgccgctcggcttcaccgatccgttc
tcgggcagcgccggctggcgcgcgcgcttcggcgacgcgccggtgtcgcagttcgtcgcc
gcgcagcggatcgccgatcactggaacctgtcacgcgacgcgatggagcgttacgcgctg
gagagtcaccgccgcgcggtcgcggcgatcgagggcggccatttcaagcgggagatcgtg
ccgttcgaaggggtgatgcatgacgagacgccgcgccccgacacgtcgctcgacaagatg
gcgacgctcgaaccgctgacgccgggcggctcgctgacggccgccgtcgcgagccagacc
tgcgatgcggccgcggcgctcctgatcgtgtcggaggaggcgctcaagcgctacgacctc
acgccgcgcgcacgcattcatcacctgagcgtgctcggcgacgatccgctgtggatgctc
accgcgccgattccggcgacccgggctgcgttgaagaagagcgggctcgatctggcgcgg
atcgacgtcgtcgagctgaacgaggcgttcgcgtcggttgcgcaggcgtggctggccgat
acgcgttttccgcacgaaaagaccaacccgaacggcggcgcgatcgcgctcggccatccg
ctcggcgcgaccggcgcgcggctgatgacgacgctgttgcacgagctggaacgcacgggc
ggccgctacgggctgcagacgatgtgcgaaggcggcggcctcgcgaacgtcacgatcatc
gagcgcctgtga

DBGET integrated database retrieval system