KEGG   Brucella ceti TE28753-12: V568_200100Help
Entry
V568_200100       CDS       T02935                                 

Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bcee  Brucella ceti TE28753-12
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bcee00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    V568_200100
Enzymes [BR:bcee01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     V568_200100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(88614..89534)
Genome map
AA seq 306 aa AA seqDB search
MKIFVFGSVNVDVSARMAALPRPGQTVNASGYGIGLGGKGANQAVAVAKLGGAIRFVGAV
GHDAFGELALKQMREFGLDTGSVRVIDDVDTGMAIIQVEETGQNTIAVCAGANARWSSAD
IDAYGADIAKARITLLQREVPHEANLAVAKAVRAAGGTVLLDPAPVGDASQMADLIALSD
IISPNETEAAEITGIEPTDLASAEAAGRKLLERGPKIVILKLGSRGALLVTADEVKHFTP
FKVKVVDTVAAGDSFNGGFAVAFSQARPLHDCVRYGSAAGAIAVTRVGAGAAAPTAREVE
ELIGRA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
ttgaagattttcgttttcggcagtgtgaatgtggatgtaagcgcccgaatggctgccctg
ccacggccggggcagacggtaaacgcatccggctatggcatcgggctgggtggcaaagga
gccaatcaggcggttgcggtggcaaaacttggcggggcaatccgatttgtcggcgcggtc
ggccatgatgcctttggcgaactggccttaaagcagatgcgcgagtttgggctggatacc
ggcagcgtgcgcgtgatcgatgacgtcgatacaggcatggcgatcatccaggtggaggaa
accgggcagaacacgattgcggtctgtgctggcgccaatgcgcgctggtcgtcagccgat
attgatgcttatggcgctgatattgccaaggcaaggattacgcttttgcagcgcgaagtg
ccgcatgaagccaatctggccgttgcgaaagccgtgcgggcagcgggtggaaccgtcctg
ctcgacccggccccggtgggggatgcaagccagatggccgatcttatcgccctgagcgac
atcatttcgcccaacgagacggaagccgctgaaatcaccggcattgagccgaccgacctc
gcttcggcggaagcggcggggcgcaagcttctggagcgcggcccgaagatcgtcatcctc
aagcttggaagccgtggcgcgctgctggtaacggcggatgaggtgaaacacttcacgccg
ttcaaggtaaaggtggtggatacggttgcagccggtgacagtttcaacggcggctttgcc
gttgctttctcgcaggcgcggcccttgcatgattgcgtgcggtatggttcggcggcgggc
gcgattgcggttacgcgggttggcgcaggcgctgccgcgccaaccgcgcgtgaggttgag
gaactcatcgggcgcgcttga

DBGET integrated database retrieval system