KEGG   Brucella ceti TE28753-12: V568_201023Help
Entry
V568_201023       CDS       T02935                                 

Gene name
gadB
Definition
glutamate decarboxylase beta (EC:4.1.1.15)
Orthology
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
bcee  Brucella ceti TE28753-12
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bcee00650]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bcee00250]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:bcee00410]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:bcee00430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(933313..934707)
Genome map
AA seq 464 aa AA seqDB search
MTGSNYPARDLIASVFGTEALQEIAASRGFREKEMQANAVYQIIHDELFLDGNARQNLAT
FCQTWDDDYVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWNAPKFADNATGTNT
IGSSEACMLGGMAMKWRWRKKMQEMGKPTDKPNFVCGPVQVCWHKFARYWDVEIREIPME
PGRLFMGPEQMLEAVDENTIGVVPTFGVTYTGNYEFPEPLQDALDKLQKTKGLDIDIHVD
AASGGFLAPFCAPDIPWDFRLPRVKSISASGHKYGLAPLGCGWVVWRDKEALPEELIFNV
DYLGGQVGTFAINFSRPAGQVISQYYEFMRLGREGYTKVQQAAYRVAQYIAREIEPLGPY
EFICAGEEKGGIPAVCFRIREGEDPGYSLYDLSERLRLTGWQVPAFALSGKASDITVMRV
MCRRGFEMDLAALFIRDFKAGIEFFKSHPSPKITPSMGTGFHHT
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgactggttcaaactatccggcgcgggatttgattgcctctgtttttggcaccgaggct
ttacaggaaattgctgcttcgcgtggttttcgcgaaaaggaaatgcaggcgaacgctgtt
taccagattattcatgacgaactgtttctcgatggtaatgcccgtcagaatctggcgacc
ttctgtcagacatgggatgatgattacgtccacaagctgatggacctttcgatcaacaag
aactggatcgacaaggaggaatatccccagtcggcggccattgatctgcgctgtgtcaac
atggtcgcggacctctggaatgcacccaaattcgccgataatgccacaggcaccaatacg
atcgggtccagcgaggcctgtatgcttggtggtatggccatgaaatggcgctggcgcaag
aagatgcaggaaatgggcaagccgacggacaagcccaatttcgtttgtggcccggtgcag
gtgtgttggcacaaattcgcccggtactgggatgtcgagatccgggaaattccgatggag
cctggccgcctgttcatgggaccagaacaaatgcttgaagccgttgatgaaaataccatc
ggcgtcgtgcccactttcggcgtgacctataccggcaattatgaatttcccgaaccgttg
caggatgcgctggacaagctgcaaaagaccaagggtcttgatatcgatatccatgtcgat
gcggcaagcggcggctttctggcaccattttgcgcgcccgatattccgtgggatttccgc
ctgccgcgcgtgaagtcgatcagcgcgtcaggccataaatacggtctcgcaccgcttggc
tgtggctgggttgtctggcgcgacaaagaggccctgccggaagagctgatcttcaatgtg
gattatctcggtggacaggttggcactttcgcaatcaatttctcgcggcctgccggtcag
gtcatttcacaatattacgaattcatgcgtcttggccgcgaaggctacaccaaggtgcag
caggcggcctaccgcgtggcgcaatatatagccagggagatcgagccgcttgggccttat
gaattcatctgcgcgggcgaggagaaaggcggcattcccgccgtctgtttccgcatccgt
gaaggcgaagaccccggttattcgctctatgatctgtcggaacggctgcgtctgaccgga
tggcaggttcccgctttcgctctttcgggcaaggcgtcggatatcactgtcatgcgcgtc
atgtgccgccgcggtttcgagatggatctggctgcactcttcattcgggatttcaaggct
gggatcgagttcttcaaatcgcatccttcaccgaagattaccccgtcgatgggaaccggc
tttcaccacacataa

DBGET integrated database retrieval system