KEGG   Burkholderia cenocepacia DDS 22E-1: DM39_4152Help
Entry
DM39_4152         CDS       T03308                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcen  Burkholderia cenocepacia DDS 22E-1
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:bcen00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DM39_4152
   00630 Glyoxylate and dicarboxylate metabolism
    DM39_4152
   00640 Propanoate metabolism
    DM39_4152
   00650 Butanoate metabolism
    DM39_4152
  Lipid metabolism
   00071 Fatty acid degradation
    DM39_4152
   00072 Synthesis and degradation of ketone bodies
    DM39_4152
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DM39_4152
   00310 Lysine degradation
    DM39_4152
   00380 Tryptophan metabolism
    DM39_4152
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DM39_4152
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DM39_4152
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DM39_4152
Enzymes [BR:bcen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DM39_4152
Exosome [BR:bcen04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DM39_4152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:complement(906973..908157)
Genome map
AA seq 394 aa AA seqDB search
MREAVVVSTARTPIGRAFRGAFNRTKSPTLMGHAIHHAIDRSGLDPARVDDVIVGTVLAA
GTAGMNIARNAMFAAGLPPSTSAQTIDRQCASGLMAIANAAKQIIVDGTEIIVAGGQENI
SAVQNTYFKWVQEEQDTNVQRFAAHAYMPMLETAEFVSRKYAISRDRQDEYALLSQSRTA
AAQANGLFDAEIAPIDVVMAVTDKETGLVTERELTFSRDEGNRPETTLSTLSALQTVIAG
GSVTAGNASQLSDGASACVLMEARAAEREGLNPLGVYRGMAVAGTAPEEMGVGPVYAIPK
LLKQHGLSVDDIGLWELNEAFACQVLYCRDALGINPAKYNVNGGAISVGHPYGMTGSRLT
GHALIEGKRRGVRYAVVGMCVGGGMGAAALFEIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagagaggctgtcgtcgtttccactgcgcgtacgccaatcggtcgcgctttccgcggc
gcattcaacaggacgaaatctcccacgctgatgggacatgcgattcaccacgccatcgat
cgatcgggtctcgatcccgcacgcgtcgatgatgtgattgttggcacggttttagcagcg
gggacagccgggatgaacatcgctcgcaacgcgatgtttgccgcagggctaccgccgtca
accagtgctcaaacgattgaccggcagtgtgcttccggtctgatggcaattgcgaatgcg
gccaagcagattatcgtcgacggcacggaaatcatcgtggctggaggccaggaaaacatc
tcggccgttcagaatacgtacttcaagtgggtacaagaagagcaggatacgaacgtccag
cgatttgcagcacacgcctatatgccgatgctcgagactgcggaattcgtttcgcgcaag
tacgctatcagccgcgatcgacaggatgagtatgcactattgtcacagtcccggaccgcg
gcggcacaggctaacggactgtttgacgccgagatcgcaccgatagacgttgtgatggcg
gtaaccgacaaagagactggactggttaccgagcgggagctgacgttttcgcgcgatgag
ggaaaccgccccgagacgacgttgtcgactctttccgcgctgcagacggttatcgcgggt
ggcagcgtaactgccgggaacgcaagccagctttctgacggcgccagtgcctgcgttttg
atggaggcacgggcagcggagagggagggattgaatccactcggcgtatatcgaggcatg
gcggtcgctggtacggcaccagaggaaatgggtgtcggcccggtctacgccattccaaaa
ctgctcaaacagcacgggctcagcgttgacgacattgggctatgggagctgaacgaagcc
tttgcgtgccaagtcttgtactgccgtgacgcgctcggcataaatcccgcgaagtacaac
gtcaacggtggggcgatctcggtggggcatccttatgggatgaccggttctcgtctaacc
ggacatgcgctaattgaaggaaaacgacgtggtgtccgctatgccgttgtgggaatgtgt
gtaggtggtggaatgggggcagctgcgctgtttgagatcgcgtag

DBGET integrated database retrieval system