KEGG   Bacillus cereus FRI-35: BCK_02055Help
Entry
BCK_02055         CDS       T02291                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bcer  Bacillus cereus FRI-35
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcer00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCK_02055
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCK_02055
  Amino acid metabolism
   00310 Lysine degradation
    BCK_02055
Enzymes [BR:bcer01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BCK_02055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
361419..362657
Genome map
AA seq 412 aa AA seqDB search
MIEIKVPELAESITEGTISQWLINVGDKVEKGGSVVELETDKVNVEIIAEDSGIVSKLLG
EPGDTVEVGATIAILDANGAPVAVSTPAPAAEQPKQETTEAPKAAAPSAEQTAALQGLPN
TNRPIASPAARKMARELGIDLNDVRSTDPLGRVRPHDVQAHAAAPKEAPAAPVAKTEFEK
PVERVKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAIMELRKERKDAFEKKHDVRLGF
MSFFTKAVVAALKQFPLLNAEIQGDELIIKKFYDIGIAVAAPDGLVVPVVRDANQLNFAE
IESEIRELGKKARDNKLSLKELQGGTFTITNGGVFGSLMSTPILNSPQVGILGMHKIQVR
PVAIDNERMENRPMMYIALSYDHRIVDGKEAVSFLVAVKDMLEDPKSLLLEG
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattaaagtacctgagcttgcagaatctattactgaaggaactatctcacaa
tggcttatcaacgtaggcgacaaagttgagaaaggtggcagcgttgttgagcttgaaact
gataaagtcaatgtagaaatcattgcagaagattcaggtattgtatcgaagttactaggt
gaacctggggatacagttgaagttggcgcaactatcgcaattttagatgcaaacggagca
ccagttgcagtaagtacgcctgcaccggctgctgagcaaccgaaacaagaaacaactgaa
gcaccaaaagctgcggcaccaagtgctgaacaaactgcagctttacaaggtttaccaaat
acaaaccgtcctatcgcatcaccagctgctagaaaaatggctcgtgaattaggaatcgac
ttaaacgacgtacgtagcacagatccacttggacgtgtgagaccacacgatgtacaagct
catgctgcagcaccaaaagaagcaccagctgctccagttgcaaaaactgaatttgaaaaa
ccagttgagcgcgtgaaaatgtcccgccgccgtcaaacaattgcaaaacgccttgtagaa
gttcaacaaacatctgcaatgttaacaacatttaacgaagttgatatgactgcaatcatg
gaattacgtaaagagcgtaaagacgcttttgagaaaaaacatgatgtacgtcttggtttc
atgtcattcttcacaaaagcagttgttgcagcattaaaacaattcccattattaaatgct
gaaattcaaggtgacgagcttatcattaaaaaattctatgatatcggtattgcagtagca
gctccagatggattagttgttccagttgtacgcgatgcgaaccaattaaacttcgctgaa
atcgaaagcgaaattcgtgaattaggtaaaaaagcacgtgacaacaaactttcattaaaa
gaactacaaggtggtacatttacaattacaaacggtggcgtgttcggttctctaatgtca
acaccgatcctaaacagcccacaagttggtattttaggaatgcacaaaatccaagtacgt
cctgttgcaattgataacgaacgtatggaaaaccgcccaatgatgtacatcgctttatct
tacgatcaccgtatcgttgatggtaaagaagcagttagcttccttgttgctgttaaagat
atgcttgaagatccaaaatcattattattagaaggttga

DBGET integrated database retrieval system