KEGG   Bacillus cereus FRI-35: BCK_02055Help
Entry
BCK_02055         CDS       T02291                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bcer  Bacillus cereus FRI-35
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bcer01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bcer00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:bcer00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
361419..362657
Genome map
AA seq 412 aa AA seqDB search
MIEIKVPELAESITEGTISQWLINVGDKVEKGGSVVELETDKVNVEIIAEDSGIVSKLLG
EPGDTVEVGATIAILDANGAPVAVSTPAPAAEQPKQETTEAPKAAAPSAEQTAALQGLPN
TNRPIASPAARKMARELGIDLNDVRSTDPLGRVRPHDVQAHAAAPKEAPAAPVAKTEFEK
PVERVKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAIMELRKERKDAFEKKHDVRLGF
MSFFTKAVVAALKQFPLLNAEIQGDELIIKKFYDIGIAVAAPDGLVVPVVRDANQLNFAE
IESEIRELGKKARDNKLSLKELQGGTFTITNGGVFGSLMSTPILNSPQVGILGMHKIQVR
PVAIDNERMENRPMMYIALSYDHRIVDGKEAVSFLVAVKDMLEDPKSLLLEG
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattaaagtacctgagcttgcagaatctattactgaaggaactatctcacaa
tggcttatcaacgtaggcgacaaagttgagaaaggtggcagcgttgttgagcttgaaact
gataaagtcaatgtagaaatcattgcagaagattcaggtattgtatcgaagttactaggt
gaacctggggatacagttgaagttggcgcaactatcgcaattttagatgcaaacggagca
ccagttgcagtaagtacgcctgcaccggctgctgagcaaccgaaacaagaaacaactgaa
gcaccaaaagctgcggcaccaagtgctgaacaaactgcagctttacaaggtttaccaaat
acaaaccgtcctatcgcatcaccagctgctagaaaaatggctcgtgaattaggaatcgac
ttaaacgacgtacgtagcacagatccacttggacgtgtgagaccacacgatgtacaagct
catgctgcagcaccaaaagaagcaccagctgctccagttgcaaaaactgaatttgaaaaa
ccagttgagcgcgtgaaaatgtcccgccgccgtcaaacaattgcaaaacgccttgtagaa
gttcaacaaacatctgcaatgttaacaacatttaacgaagttgatatgactgcaatcatg
gaattacgtaaagagcgtaaagacgcttttgagaaaaaacatgatgtacgtcttggtttc
atgtcattcttcacaaaagcagttgttgcagcattaaaacaattcccattattaaatgct
gaaattcaaggtgacgagcttatcattaaaaaattctatgatatcggtattgcagtagca
gctccagatggattagttgttccagttgtacgcgatgcgaaccaattaaacttcgctgaa
atcgaaagcgaaattcgtgaattaggtaaaaaagcacgtgacaacaaactttcattaaaa
gaactacaaggtggtacatttacaattacaaacggtggcgtgttcggttctctaatgtca
acaccgatcctaaacagcccacaagttggtattttaggaatgcacaaaatccaagtacgt
cctgttgcaattgataacgaacgtatggaaaaccgcccaatgatgtacatcgctttatct
tacgatcaccgtatcgttgatggtaaagaagcagttagcttccttgttgctgttaaagat
atgcttgaagatccaaaatcattattattagaaggttga

DBGET integrated database retrieval system