KEGG   Bacillus cereus FRI-35: BCK_02055Help
Entry
BCK_02055         CDS       T02291                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bcer  Bacillus cereus FRI-35
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcer00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BCK_02055
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCK_02055
  Amino acid metabolism
   00310 Lysine degradation
    BCK_02055
Enzymes [BR:bcer01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BCK_02055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
361419..362657
Genome map
AA seq 412 aa AA seqDB search
MIEIKVPELAESITEGTISQWLINVGDKVEKGGSVVELETDKVNVEIIAEDSGIVSKLLG
EPGDTVEVGATIAILDANGAPVAVSTPAPAAEQPKQETTEAPKAAAPSAEQTAALQGLPN
TNRPIASPAARKMARELGIDLNDVRSTDPLGRVRPHDVQAHAAAPKEAPAAPVAKTEFEK
PVERVKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAIMELRKERKDAFEKKHDVRLGF
MSFFTKAVVAALKQFPLLNAEIQGDELIIKKFYDIGIAVAAPDGLVVPVVRDANQLNFAE
IESEIRELGKKARDNKLSLKELQGGTFTITNGGVFGSLMSTPILNSPQVGILGMHKIQVR
PVAIDNERMENRPMMYIALSYDHRIVDGKEAVSFLVAVKDMLEDPKSLLLEG
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattaaagtacctgagcttgcagaatctattactgaaggaactatctcacaa
tggcttatcaacgtaggcgacaaagttgagaaaggtggcagcgttgttgagcttgaaact
gataaagtcaatgtagaaatcattgcagaagattcaggtattgtatcgaagttactaggt
gaacctggggatacagttgaagttggcgcaactatcgcaattttagatgcaaacggagca
ccagttgcagtaagtacgcctgcaccggctgctgagcaaccgaaacaagaaacaactgaa
gcaccaaaagctgcggcaccaagtgctgaacaaactgcagctttacaaggtttaccaaat
acaaaccgtcctatcgcatcaccagctgctagaaaaatggctcgtgaattaggaatcgac
ttaaacgacgtacgtagcacagatccacttggacgtgtgagaccacacgatgtacaagct
catgctgcagcaccaaaagaagcaccagctgctccagttgcaaaaactgaatttgaaaaa
ccagttgagcgcgtgaaaatgtcccgccgccgtcaaacaattgcaaaacgccttgtagaa
gttcaacaaacatctgcaatgttaacaacatttaacgaagttgatatgactgcaatcatg
gaattacgtaaagagcgtaaagacgcttttgagaaaaaacatgatgtacgtcttggtttc
atgtcattcttcacaaaagcagttgttgcagcattaaaacaattcccattattaaatgct
gaaattcaaggtgacgagcttatcattaaaaaattctatgatatcggtattgcagtagca
gctccagatggattagttgttccagttgtacgcgatgcgaaccaattaaacttcgctgaa
atcgaaagcgaaattcgtgaattaggtaaaaaagcacgtgacaacaaactttcattaaaa
gaactacaaggtggtacatttacaattacaaacggtggcgtgttcggttctctaatgtca
acaccgatcctaaacagcccacaagttggtattttaggaatgcacaaaatccaagtacgt
cctgttgcaattgataacgaacgtatggaaaaccgcccaatgatgtacatcgctttatct
tacgatcaccgtatcgttgatggtaaagaagcagttagcttccttgttgctgttaaagat
atgcttgaagatccaaaatcattattattagaaggttga

DBGET integrated database retrieval system