KEGG   Bacillus cereus FRI-35: BCK_02055Help
Entry
BCK_02055         CDS       T02291                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bcer  Bacillus cereus FRI-35
Pathway
bcer00020  Citrate cycle (TCA cycle)
bcer00310  Lysine degradation
bcer01100  Metabolic pathways
bcer01110  Biosynthesis of secondary metabolites
bcer01120  Microbial metabolism in diverse environments
bcer01130  Biosynthesis of antibiotics
bcer01200  Carbon metabolism
Module
bcer_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcer_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcer00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCK_02055
  Amino acid metabolism
   00310 Lysine degradation
    BCK_02055
Enzymes [BR:bcer01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BCK_02055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Orai-1 YjbH
Motif
Other DBs
NCBI-ProteinID: AFQ08321
Position
361419..362657
Genome map
AA seq 412 aa AA seqDB search
MIEIKVPELAESITEGTISQWLINVGDKVEKGGSVVELETDKVNVEIIAEDSGIVSKLLG
EPGDTVEVGATIAILDANGAPVAVSTPAPAAEQPKQETTEAPKAAAPSAEQTAALQGLPN
TNRPIASPAARKMARELGIDLNDVRSTDPLGRVRPHDVQAHAAAPKEAPAAPVAKTEFEK
PVERVKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAIMELRKERKDAFEKKHDVRLGF
MSFFTKAVVAALKQFPLLNAEIQGDELIIKKFYDIGIAVAAPDGLVVPVVRDANQLNFAE
IESEIRELGKKARDNKLSLKELQGGTFTITNGGVFGSLMSTPILNSPQVGILGMHKIQVR
PVAIDNERMENRPMMYIALSYDHRIVDGKEAVSFLVAVKDMLEDPKSLLLEG
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattaaagtacctgagcttgcagaatctattactgaaggaactatctcacaa
tggcttatcaacgtaggcgacaaagttgagaaaggtggcagcgttgttgagcttgaaact
gataaagtcaatgtagaaatcattgcagaagattcaggtattgtatcgaagttactaggt
gaacctggggatacagttgaagttggcgcaactatcgcaattttagatgcaaacggagca
ccagttgcagtaagtacgcctgcaccggctgctgagcaaccgaaacaagaaacaactgaa
gcaccaaaagctgcggcaccaagtgctgaacaaactgcagctttacaaggtttaccaaat
acaaaccgtcctatcgcatcaccagctgctagaaaaatggctcgtgaattaggaatcgac
ttaaacgacgtacgtagcacagatccacttggacgtgtgagaccacacgatgtacaagct
catgctgcagcaccaaaagaagcaccagctgctccagttgcaaaaactgaatttgaaaaa
ccagttgagcgcgtgaaaatgtcccgccgccgtcaaacaattgcaaaacgccttgtagaa
gttcaacaaacatctgcaatgttaacaacatttaacgaagttgatatgactgcaatcatg
gaattacgtaaagagcgtaaagacgcttttgagaaaaaacatgatgtacgtcttggtttc
atgtcattcttcacaaaagcagttgttgcagcattaaaacaattcccattattaaatgct
gaaattcaaggtgacgagcttatcattaaaaaattctatgatatcggtattgcagtagca
gctccagatggattagttgttccagttgtacgcgatgcgaaccaattaaacttcgctgaa
atcgaaagcgaaattcgtgaattaggtaaaaaagcacgtgacaacaaactttcattaaaa
gaactacaaggtggtacatttacaattacaaacggtggcgtgttcggttctctaatgtca
acaccgatcctaaacagcccacaagttggtattttaggaatgcacaaaatccaagtacgt
cctgttgcaattgataacgaacgtatggaaaaccgcccaatgatgtacatcgctttatct
tacgatcaccgtatcgttgatggtaaagaagcagttagcttccttgttgctgttaaagat
atgcttgaagatccaaaatcattattattagaaggttga

DBGET integrated database retrieval system