KEGG   Bacillus cereus FRI-35: BCK_02130Help
Entry
BCK_02130         CDS       T02291                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bcer  Bacillus cereus FRI-35
Pathway
bcer00260  Glycine, serine and threonine metabolism
bcer00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bcer01100  Metabolic pathways
bcer01110  Biosynthesis of secondary metabolites
bcer01130  Biosynthesis of antibiotics
bcer01230  Biosynthesis of amino acids
Module
bcer_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bcer00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCK_02130 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCK_02130 (trpA)
Enzymes [BR:bcer01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BCK_02130 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA PcrB Peripla_BP_4 PucR
Motif
Other DBs
NCBI-ProteinID: AFQ08336
Position
complement(377676..378452)
Genome map
AA seq 258 aa AA seqDB search
MGVEKIKAAFENGKKAFIPYVMGGDGGLEKLKERIRFLDEAGASIVEIGIPFSDPVADGP
TIQRAGKRALDSGVTVKGIFQALIEVRKEVQIPFVLMTYLNPVLAFGKEQFIENCIEAGV
DGIIVPDLPYEEQDIIAPLLRTANIALIPLVTVTSPIERIEKITSESEGFVYAVTVAGVT
GVRQNFKEEIHSYLEKVKSHTHLPVVAGFGISTKEHVEDMITICDGVVVGSKVIELLENE
KREEICELIQATKQKEEA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgggagtagaaaaaattaaagcagcatttgaaaatggtaagaaagcatttattccgtac
gtaatgggcggagatggtggccttgaaaagttaaaagaaagaattcgttttctagatgaa
gcaggagcaagcatcgttgaaattggtatcccattttcagatccagttgcagatggccca
acaattcaaagggcagggaaacgagcactagatagcggtgtaacagtaaaaggcattttt
caagcattaatagaggtaaggaaagaagtacaaattccgtttgtacttatgacatattta
aatccagtactcgcattcggaaaagaacaattcatcgaaaattgtatagaagcaggggtg
gacggtattatcgttccagatttaccgtatgaagaacaagacattattgcaccgcttctc
cgaactgcaaatatcgctttaatcccactcgttaccgttacaagcccaattgagcgaatc
gagaaaattacgagtgaatcagaagggttcgtctacgccgttacagtagcgggcgtaaca
ggcgtacgtcaaaattttaaagaggagattcatagttatttagaaaaagtaaaatcacat
acgcatttaccggtagtggcagggttcggtatttcaacgaaggaacatgtagaagacatg
attacaatatgtgacggagttgtcgttggaagtaaagtgattgagctgttagaaaatgaa
aaacgagaagaaatatgtgaattaatacaggcaacaaaacaaaaagaagaggcataa

DBGET integrated database retrieval system