KEGG   Bacillus cereus FRI-35: BCK_02145Help
Entry
BCK_02145         CDS       T02291                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bcer  Bacillus cereus FRI-35
Pathway
bcer00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bcer01100  Metabolic pathways
bcer01110  Biosynthesis of secondary metabolites
bcer01130  Biosynthesis of antibiotics
bcer01230  Biosynthesis of amino acids
Module
bcer_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bcer00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCK_02145 (trpC)
Enzymes [BR:bcer01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BCK_02145 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh His_biosynth
Motif
Other DBs
NCBI-ProteinID: AFQ08339
Position
complement(380257..381018)
Genome map
AA seq 253 aa AA seqDB search
MGTILDKIVEQKKKEVATLYETYTPIKESRKTHSLVESLQQFTVIAEVKRASPSKGDINL
HVDVRKQVETYEECGAGAVSVLTDGQFFKGSFYDLQTAREESNIPLLCKDFIIDKIQIDR
AYEAGADIILLIVAALPKEKLKELYSYVLEKGLEAIVEIHDEEELEIAIELNPHVIGINN
RNLKTFEVDLGQTEKLGKRLNEEKLLWISESGIHSKEDIIRVKRAGAKGVLVGEALMTSS
SIRTFFEDCKVNI
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtggggacgattttagataaaattgtagaacagaagaaaaaggaagttgcgacattatat
gaaacatatacaccaataaaagaaagtagaaagacacattcactcgtagaatcattacag
cagtttactgttattgcagaagtaaagcgagcatcaccatcaaaaggagatatcaattta
cacgttgatgtacgaaaacaagtggaaacatacgaagaatgcggcgcaggagcagtttct
gttttaacagacggtcaattttttaaaggttcgttttatgatttacaaacggcgagagaa
gaaagtaacattccgcttttatgtaaagatttcataattgataagattcaaattgataga
gcgtatgaggctggcgcagatattattttattaattgtagcagcgttaccgaaagagaag
ttaaaagagctgtatagctacgtactagaaaaagggttagaagcaattgttgaaattcat
gatgaagaggaattagaaattgcaatcgaattaaatccgcacgttatcggtattaacaac
cgtaatttaaaaacattcgaagtcgatttaggccaaacagaaaagcttggaaaacgatta
aatgaggagaaattactttggattagtgagagcggaattcattcaaaagaagatataatc
cgcgtcaagcgagctggagcaaaaggtgtattagttggagaggcacttatgacatcatct
tctattcgcaccttttttgaagattgtaaggtgaacatatga

DBGET integrated database retrieval system