KEGG   Bacillus cereus FRI-35: BCK_03130Help
Entry
BCK_03130         CDS       T02291                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bcer  Bacillus cereus FRI-35
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bcer00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(569037..570527)
Genome map
AA seq 496 aa AA seqDB search
MKKYILSLDQGTTSSRAILFNKKGEIVHSAQKEFTQHFPKPGWVEHNAQEIWGSILAVIA
TCLSEADVKPEQIAGIGITNQRETAVVWDKTTGKPIYNAIVWQSRQTAEICDELKEKGYG
EMVREKTGLLIDAYFSGTKVKWILDNVEGAREKAENGDLLFGTIDTWLVWKLSGGKAHVT
DYSNASRTLMFNIHDLQWDDELLDMLTVPKSMLPEVRPSSEVYGETIDYHFFGQNVPIAG
VAGDQQAALFGQACFGEGMAKNTYGTGCFMLMNTGEKAVASEHGLLTTIAWGIDGKVNYA
LEGSIFVAGSAIQWLRDGMRMFKDASESEVYASRVESTDGVYVVPAFVGLGTPYWDSEVR
GAMFGVTRGTTKEHFIRATLESLAYQTKDVLCAMEADSGIELKTLRVDGGAVKNNFLMKF
QSDILDVPVERPVINETTALGAAYLAGLAVGYWKNQDEIKEQWHMDKRFEPTMEAETSKE
LYAGWKKAIEATKAFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatattctttcattagaccaaggaacaactagctcacgtgcaattctgttc
aataaaaagggtgaaattgttcattcagctcaaaaagaatttacacaacattttccaaag
ccaggctgggtagagcataacgcacaagaaatttggggatctattttagcggttatcgca
acttgcttaagcgaagcagatgtaaaaccagaacaaatcgctggtatcggtattacgaac
caacgtgaaacagcggttgtatgggataaaacaacaggcaaaccaatttataacgcaatc
gtatggcaatctcgccaaacagctgaaatttgtgatgagttaaaagaaaaaggttatggc
gaaatggttcgcgaaaaaacaggtcttttaattgacgcatatttctctggtacgaaagta
aaatggattttagataacgttgaaggtgcaagagagaaagcagaaaacggcgatctatta
ttcggaacaattgatacatggcttgtatggaaactatctggtggtaaagcgcacgtaacg
gattactcaaatgcatcacgtacgttaatgtttaacattcacgacttacaatgggatgat
gaacttctagacatgttaacagtaccaaagagcatgcttccagaagtacgtccatcatct
gaagtgtatggagaaacaattgactatcacttcttcggtcaaaatgtaccgattgccggt
gtagctggtgaccaacaagcagcattatttggacaagcttgtttcggtgaaggtatggcg
aaaaatacttacggaactggttgcttcatgttaatgaacactggtgaaaaagcagtagct
tctgagcatggtctattaacaacaattgcatggggaatagatggtaaagtaaactacgca
ttagaaggaagtattttcgtagcaggttctgcaattcaatggttacgtgacggaatgcgc
atgtttaaagatgcaagtgagagtgaagtgtatgcttctcgcgttgaatcaactgacggt
gtatacgttgtaccagcattcgtaggattaggtacaccttactgggatagtgaagtacgc
ggtgctatgtttggtgtaacacgcggtacgacgaaagagcatttcattcgtgcaacacta
gaatctttagcttaccaaacgaaagacgtattatgcgcaatggaagcagattcaggtatt
gaactgaaaacattacgcgttgatggcggagcagttaaaaataacttcttaatgaagttc
caaagtgatattttagatgttcctgtagagcgtccggtgatcaatgaaacaacagcttta
ggtgcagcgtacttagctggtcttgcggttggatattggaaaaaccaagatgaaattaaa
gaacagtggcatatggacaaacgctttgaaccaacaatggaagcggaaacaagcaaagag
ctatatgctggatggaaaaaagcaattgaagcaacaaaagctttcaaataa

DBGET integrated database retrieval system