KEGG   Bacillus cereus FRI-35: BCK_04820Help
Entry
BCK_04820         CDS       T02291                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bcer  Bacillus cereus FRI-35
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bcer00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BCK_04820
Enzymes [BR:bcer01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BCK_04820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(905889..906785)
Genome map
AA seq 298 aa AA seqDB search
MPNIAVVGSISMDLVAVSKKRPKAGETVIGEAFHTIPGGKGANQAVAAARLGANVAMVGA
VGDDNYGTVVRKNLENERVFIDYVVPVTDTATGIAHIVLAEEDNSIVVVQGANALVNESV
VNRSKDLLTKADMVVLQLEIPLETVKYVLAICEEHKIPVMLNPAPAQVLSEDILEKATYI
TPNEHECRIVLDDFTSPIEELLAKYPNKLLMTEGSNGVRFHNGTEIVHVPSIAVDVVDTT
GAGDTFNGALAVALSEGETLQKAIRFANIAGGLSVTKLGAQGGMPTRDKVREVQVIVG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatattgcagtagtaggtagtatttcaatggacttagtggccgtttcaaaaaaa
cgtccgaaagcaggggaaacagtaattggtgaagcatttcatacaattccaggagggaaa
ggagctaaccaggcggttgctgcagcgagattaggcgcaaatgtagcgatggttggagcg
gtaggagacgataattatggaactgtagttagaaaaaatttagagaacgaacgcgttttt
atcgactatgtggtaccggttacagatacggcgacaggaattgctcatatcgttttagca
gaagaggataacagtattgttgtcgtgcaaggagcgaatgctcttgtcaatgagtcggtt
gtaaatcgttcaaaagatcttcttacaaaagcagatatggttgtgcttcaactagagatt
ccacttgaaacagtaaaatatgtattggctatttgtgaggaacacaaaatcccggttatg
ttaaacccagcgccagcacaagtgttatcagaagatattttagaaaaggcaacttatatt
acgccaaatgaacatgagtgccgcattgtattagatgatttcacatcaccaattgaagag
ttactggctaaatatccaaacaaactattgatgacagaaggttctaacggtgtacgtttc
cataatggtacggagattgtacatgttcctagcattgctgttgatgtagtagatacgact
ggagctggtgatacatttaatggtgcattagcagttgcgctttctgaaggagaaacactt
caaaaagcaattcgttttgcgaatattgctggtggtctttctgtaacgaaacttggggcg
caaggcggtatgccaacgagagataaagtacgtgaagtgcaggtgattgtcggatga

DBGET integrated database retrieval system