KEGG   Bacillus cereus FRI-35: BCK_05630Help
Entry
BCK_05630         CDS       T02291                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bcer  Bacillus cereus FRI-35
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcer00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BCK_05630
   00330 Arginine and proline metabolism
    BCK_05630
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BCK_05630
Enzymes [BR:bcer01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BCK_05630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1097313..1098242
Genome map
AA seq 309 aa AA seqDB search
MQCIETNNLQQLLEQVKPYTKKGKLATYIPELGNANPDDLGIAIFHKETEYIHAGNSQTL
FTLQSISKVITLALALLDRGEEYVFSKVGMEPTGDPFNSIIKLETTSPSKPLNPMINAGA
LAITSMLAGKDNEEKMERILHFVREITDNPTINYSSKVANSELETAYLNRSLCYYMKQNG
IIDCDIEELMDLYTRQCAVEVNCIDLARIGLIFAMDGYDPYKKKQIIPKHITKICKTFMV
TCGMYNESGEFAIRVGIPAKSGVAGGIFGCVKGEMGIGIFGPALDANGNSIAGFKILELL
SAQEGWSIF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgcattgaaacaaacaacttacaacagttgttagaacaagtaaaaccatatacg
aaaaaaggaaagcttgctacttatatccccgaactaggaaatgccaatccagatgattta
gggattgccattttccataaagaaacagaatacatccatgctggcaactcacaaacacta
ttcactcttcaaagtatttcaaaagtaattacacttgcacttgcccttttagatcgtggt
gaagaatatgtattttctaaagttggaatggaaccaactggtgatccatttaattctatt
attaagttagaaacgacaagtccttctaaaccacttaatccaatgattaatgcgggggca
ctagccattacaagcatgttagcaggtaaagataatgaagaaaaaatggagcgcattctt
catttcgtacgtgaaataacagataatcctactattaattattcttctaaagttgctaat
tcagaattagagacagcttacttaaatcgctcactttgttactatatgaaacaaaacgga
attatcgattgtgacattgaagagctgatggatttatacactcgtcaatgtgcagttgag
gtaaactgtatcgatttagcacgtatcggcttaatttttgcgatggatggatatgatcca
tataagaaaaaacaaattatccctaagcatattacaaagatttgtaaaacatttatggtt
acatgcggtatgtataacgagtctggtgaatttgcgattcgtgttggtatccccgcaaaa
agtggtgtagctggtggcattttcggctgcgtaaaaggagaaatgggaattggtattttc
ggaccagctttagatgcaaacggaaatagcatcgctggttttaaaatccttgaacttctt
tctgctcaagaaggttggagcattttttaa

DBGET integrated database retrieval system