KEGG   Bacillus cereus FRI-35: BCK_06155Help
Entry
BCK_06155         CDS       T02291                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bcer  Bacillus cereus FRI-35
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcer00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BCK_06155
Enzymes [BR:bcer01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BCK_06155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1204510..1205151)
Genome map
AA seq 213 aa AA seqDB search
MLLQKEREEIVAYGKKMISSGLTKGTGGNISIFNREQGLVAISPSGLDYYETKPEDVVIL
NLDGDVVEGERKPSSELDMHLIYYRKREDINALVHTHSPYAKTIASLGWELPAVSYLIAF
AGPNVRCAPYETFGTKQLAEAAFEGMIDRRAVLLANHGLIAGANHIKMAFTVAEEIEFCA
QIYYQTKSVGEPKLLPEDEMENLAKKFEGYGQQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgttattacaaaaagagagagaagaaattgtagcgtatggaaagaaaatgatttctagc
ggtttaacaaaggggacaggcggtaatattagtattttcaatcgcgagcaaggtcttgtt
gccattagcccaagtggtttagattattatgaaacgaagcctgaagatgtagttatatta
aacttagatggcgatgtagtagagggagagagaaaaccatcgagcgaactcgatatgcac
cttatttattatagaaagcgtgaagatataaatgcgcttgtgcatacacattctccttat
gcgaagacgattgcatcattaggatgggaactgcccgcagtatcgtatttaattgctttc
gcaggccctaatgttcgttgtgcaccgtatgaaacatttggtacgaagcaattagcagag
gcggctttcgaagggatgattgatcgccgtgctgttttacttgcgaatcacggtttaatt
gcgggtgcaaatcatataaaaatggcatttaccgttgcagaagaaattgagttttgtgcg
caaatttattatcaaacgaaaagcgtcggagagcctaagttattgccagaagatgagatg
gagaatttggcgaagaagtttgaagggtatggacagcaataa

DBGET integrated database retrieval system