KEGG   Bacillus cereus FRI-35: BCK_06155Help
Entry
BCK_06155         CDS       T02291                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bcer  Bacillus cereus FRI-35
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bcer00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1204510..1205151)
Genome map
AA seq 213 aa AA seqDB search
MLLQKEREEIVAYGKKMISSGLTKGTGGNISIFNREQGLVAISPSGLDYYETKPEDVVIL
NLDGDVVEGERKPSSELDMHLIYYRKREDINALVHTHSPYAKTIASLGWELPAVSYLIAF
AGPNVRCAPYETFGTKQLAEAAFEGMIDRRAVLLANHGLIAGANHIKMAFTVAEEIEFCA
QIYYQTKSVGEPKLLPEDEMENLAKKFEGYGQQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgttattacaaaaagagagagaagaaattgtagcgtatggaaagaaaatgatttctagc
ggtttaacaaaggggacaggcggtaatattagtattttcaatcgcgagcaaggtcttgtt
gccattagcccaagtggtttagattattatgaaacgaagcctgaagatgtagttatatta
aacttagatggcgatgtagtagagggagagagaaaaccatcgagcgaactcgatatgcac
cttatttattatagaaagcgtgaagatataaatgcgcttgtgcatacacattctccttat
gcgaagacgattgcatcattaggatgggaactgcccgcagtatcgtatttaattgctttc
gcaggccctaatgttcgttgtgcaccgtatgaaacatttggtacgaagcaattagcagag
gcggctttcgaagggatgattgatcgccgtgctgttttacttgcgaatcacggtttaatt
gcgggtgcaaatcatataaaaatggcatttaccgttgcagaagaaattgagttttgtgcg
caaatttattatcaaacgaaaagcgtcggagagcctaagttattgccagaagatgagatg
gagaatttggcgaagaagtttgaagggtatggacagcaataa

DBGET integrated database retrieval system