KEGG   Bacillus cereus FRI-35: BCK_07440Help
Entry
BCK_07440         CDS       T02291                                 

Gene name
gltX
Definition
glutamyl-tRNA ligase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
bcer  Bacillus cereus FRI-35
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bcer00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    BCK_07440 (gltX)
Enzymes [BR:bcer01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     BCK_07440 (gltX)
Amino acid related enzymes [BR:bcer01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   BCK_07440 (gltX)
Transfer RNA biogenesis [BR:bcer03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BCK_07440 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1476301..1477758)
Genome map
AA seq 485 aa AA seqDB search
MEKQVRVRYAPSPTGHLHIGNARTALFNYLFARHQDGKFIIRIEDTDVKRNVAGGEESQL
KYLKWLGMDWDEGVDVGGEFGPYRQTERLDIYKKLYEDLLERGLAYKCYMTEEELEAERE
GQIARGETPRYAGNHRDLTEAQVKEFEAEGRIPSIRFRVPADRDYTFKDIVKDEVAFHSN
DFGDFVIVKKDGIPTYNFAVAVDDHLMEITHVLRGDDHISNTPKQMMIYEAFGWDIPQFG
HMTLIVNESRKKLSKRDESIIQFIEQYKELGYLPEAIFNFIALLGWSPVGEEEIFSQEEF
IKMFDAARLSKSPALFDSQKLKWMNNQYMKKQDLDTVVELSLPHLVKAGRIGETLSEQEQ
AWIRDVIALYHEQMSFGAEIVELSEMFFKDHVDYEEEGQEVLKGEQVPEVLRAFAGQVEA
LEAMEPAAIKAAIKAVQKETGHKGKNLFMPIRVATTGQTHGPELPNAIALLGKEKVLNRL
QKVIG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagcaagtgagagtgcgctatgcgccaagtccaacaggacacttacatatcgga
aatgcgcgtacggcattatttaattatttatttgctcgtcatcaagatggtaagtttatt
attcgtattgaagatactgatgtaaaacgtaatgttgctggtggagaagaaagccaatta
aaatacttgaaatggctcggtatggactgggatgaaggtgttgatgttggtggtgaattt
ggaccatatcgtcaaacagagcgtttagatatttataaaaagttatatgaagatttatta
gagcgtggtttagcttacaaatgttatatgacagaagaagaactagaagcagaacgcgaa
gggcaaattgctcgtggtgaaacacctcgttacgcaggtaaccaccgtgatttaactgaa
gcgcaagtgaaagaatttgaagctgagggacgtattccaagtattcgtttccgtgtacca
gctgaccgtgattacacatttaaagatattgtaaaagatgaagttgcattccattcaaat
gatttcggtgatttcgttattgtgaaaaaagatgggattccaacttataactttgcagta
gcagtagatgatcacttaatggaaattacacacgtgcttcgtggtgatgaccatatttca
aacactccaaaacaaatgatgatttatgaagctttcggttgggatattccacaattcggt
catatgactttaattgtaaatgaaagccgtaaaaaattaagtaagcgtgatgaatctatt
attcaatttattgagcaatataaagagcttggatatcttccagaagcaatctttaacttt
attgcattactaggttggtcgccagtaggagaagaagaaatcttctctcaagaagagttt
atcaaaatgttcgatgcagctcgtttatcaaaatcacctgcattatttgattctcaaaaa
ctaaaatggatgaacaaccaatatatgaaaaagcaagatttagatacggtagtagaatta
agcttaccgcatttagtgaaggctggacgtataggtgaaactttaagtgaacaagaacaa
gcgtggattcgtgatgtaattgcgttatatcatgaacaaatgagctttggagctgaaatt
gtagagctttctgaaatgttcttcaaagatcatgttgattatgaagaagaaggacaagaa
gtattaaaaggtgaacaagtaccagaagtacttcgtgcatttgctggtcaagtagaagca
ctagaagctatggaaccggcagcaattaaggcggctattaaggcagttcaaaaggaaaca
ggtcataaaggtaaaaacttatttatgccaatccgtgttgcaactactggtcaaacacac
ggcccagagcttcctaatgctattgcacttcttggaaaagaaaaagttttaaatcgtctt
caaaaagtaattggttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system